OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMA4 (NM_001102667) Human Mass Spec Standard

Be the first to review this product
SKU
PH320385
PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504059 PSMA4 mouse monoclonal antibody, clone OTI4B8 (formerly 4B8) 100 ul
$447.00
LY419117 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PSMA4 or NM_001102667"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220385
Predicted MW 29.5 kDa
Protein Sequence
Protein Sequence
>RC220385 protein sequence
Red=Cloning site Green=Tags(s)

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE
DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD
KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK
VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001096137
RefSeq Size 1159
RefSeq ORF 783
Synonyms HC9; HsT17706; PSC9
Locus ID 5685
UniProt ID P25789
Cytogenetics 15q25.1
Summary This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. provided by RefSeq, Aug 2016
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMA4" proteins (9)
SKU Description Size Price
PH302786 PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) 10 ug
$3,360.00
LC419117 Lyophilized PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420186 Lyophilized PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420187 Lyophilized PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419117 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420186 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420187 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP302786 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg 20 ug
$867.00
TP320385 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products