PSMA4 (NM_002789) Human Mass Spec Standard

SKU
PH302786
PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202786]
Predicted MW 29.5 kDa
Protein Sequence
Protein Sequence
>RC202786 protein sequence
Red=Cloning site Green=Tags(s)

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE
DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD
KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK
VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002780
RefSeq Size 1235
RefSeq ORF 783
Synonyms HC9; HsT17706; PSC9
Locus ID 5685
UniProt ID P25789
Cytogenetics 15q25.1
Summary This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Write Your Own Review
You're reviewing:PSMA4 (NM_002789) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320385 PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) 10 ug
$3,255.00
LC419117 PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420186 PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420187 PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419117 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 100 ug
$436.00
LY420186 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 100 ug
$436.00
LY420187 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 100 ug
$436.00
TP302786 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320385 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.