PSMA4 (NM_001102667) Human Recombinant Protein
SKU
TP320385
Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC220385 protein sequence
Red=Cloning site Green=Tags(s) MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001096137 |
Locus ID | 5685 |
UniProt ID | P25789 |
Cytogenetics | 15q25.1 |
RefSeq Size | 1159 |
RefSeq ORF | 783 |
Synonyms | HC9; HsT17706; PSC9 |
Summary | This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302786 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) | 10 ug |
$3,255.00
|
|
PH320385 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) | 10 ug |
$3,255.00
|
|
LC419117 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420186 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420187 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419117 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 | 100 ug |
$436.00
|
|
LY420186 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 | 100 ug |
$436.00
|
|
LY420187 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 | 100 ug |
$436.00
|
|
TP302786 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.