OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LYPLA2 (NM_007260) Human Mass Spec Standard

Be the first to review this product
SKU
PH302021
LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365341 LYPLA2 rabbit polyclonal antibody
100 ul
$310.00
LY416098 Transient overexpression lysate of lysophospholipase II (LYPLA2) (as WB positive control) 100 ug
$436.00

Other products for "LYPLA2 or NM_007260"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202021
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC202021 protein sequence
Red=Cloning site Green=Tags(s)

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA
GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH
SSCPQEMAAVKEFLEKLLPPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009191
RefSeq Size 1648
RefSeq ORF 693
Synonyms APT-2; APT2; DJ886K2.4
Locus ID 11313
UniProt ID O95372
Cytogenetics 1p36.11
Summary Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. provided by RefSeq, Jul 2008
Protein Pathways Glycerophospholipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LYPLA2" proteins (4)
SKU Description Size Price
LC416098 Lyophilized LYPLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416098 Transient overexpression lysate of lysophospholipase II (LYPLA2) (as WB positive control) 100 ug
$436.00
TP302021 Recombinant protein of human lysophospholipase II (LYPLA2), 20 µg 20 ug
$867.00
TP720900 Purified recombinant protein of Human lysophospholipase II (LYPLA2) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products