LYPLA2 (NM_007260) Human Recombinant Protein
SKU
TP302021
Recombinant protein of human lysophospholipase II (LYPLA2), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC202021 protein sequence
Red=Cloning site Green=Tags(s) MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH SSCPQEMAAVKEFLEKLLPPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009191 |
Locus ID | 11313 |
UniProt ID | O95372 |
Cytogenetics | 1p36.11 |
RefSeq Size | 1648 |
RefSeq ORF | 693 |
Synonyms | APT-2; APT2; DJ886K2.4 |
Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008] |
Protein Pathways | Glycerophospholipid metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302021 | LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191) | 10 ug |
$3,255.00
|
|
LC416098 | LYPLA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY416098 | Transient overexpression lysate of lysophospholipase II (LYPLA2) | 100 ug |
$436.00
|
|
TP720900 | Purified recombinant protein of Human lysophospholipase II (LYPLA2) | 10 ug |
$250.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.