LYPLA2 (NM_007260) Human Tagged ORF Clone

SKU
RC202021
LYPLA2 (Myc-DDK-tagged)-Human lysophospholipase II (LYPLA2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LYPLA2
Synonyms APT-2; APT2; DJ886K2.4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202021 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGGTAACACCATGTCTGTGCCCCTGCTCACCGATGCTGCCACCGTGTCTGGAGCTGAGCGGGAAA
CGGCCGCGGTTATTTTTTTACATGGACTTGGAGACACAGGGCACAGCTGGGCTGACGCCCTCTCCACCAT
CCGGCTCCCTCACGTCAAGTACATCTGTCCCCATGCGCCTAGGATCCCTGTGACCCTCAACATGAAGATG
GTGATGCCCTCCTGGTTTGACCTGATGGGGCTGAGTCCAGATGCCCCAGAGGACGAGGCTGGCATCAAGA
AGGCAGCAGAGAACATCAAGGCCTTGATTGAGCATGAAATGAAGAACGGGATCCCTGCCAATCGAATCGT
CCTGGGAGGCTTTTCACAGGGCGGGGCCCTGTCCCTCTACACGGCCCTCACCTGCCCCCACCCTCTGGCT
GGCATCGTGGCGTTGAGCTGCTGGCTGCCTCTGCACCGGGCCTTCCCCCAGGCAGCTAATGGCAGTGCCA
AGGACCTGGCCATACTCCAGTGCCATGGGGAGCTGGACCCCATGGTGCCCGTACGGTTTGGGGCCCTGAC
GGCTGAGAAGCTCCGGTCTGTTGTCACACCTGCCAGGGTCCAGTTCAAGACATACCCGGGTGTCATGCAC
AGCTCCTGTCCTCAGGAGATGGCAGCTGTGAAGGAATTTCTTGAGAAGCTGCTGCCTCCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202021 protein sequence
Red=Cloning site Green=Tags(s)

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA
GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH
SSCPQEMAAVKEFLEKLLPPV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007260
ORF Size 693 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007260.3
RefSeq Size 1648 bp
RefSeq ORF 696 bp
Locus ID 11313
UniProt ID O95372
Cytogenetics 1p36.11
Domains abhydrolase_2
Protein Pathways Glycerophospholipid metabolism
MW 24.7 kDa
Summary Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LYPLA2 (NM_007260) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202021L1 Lenti ORF clone of Human lysophospholipase II (LYPLA2), Myc-DDK-tagged 10 ug
$750.00
RC202021L2 Lenti ORF clone of Human lysophospholipase II (LYPLA2), mGFP tagged 10 ug
$750.00
RC202021L3 Lenti ORF clone of Human lysophospholipase II (LYPLA2), Myc-DDK-tagged 10 ug
$750.00
RC202021L4 Lenti ORF clone of Human lysophospholipase II (LYPLA2), mGFP tagged 10 ug
$750.00
RG202021 LYPLA2 (tGFP-tagged) - Human lysophospholipase II (LYPLA2) 10 ug
$650.00
SC115622 LYPLA2 (untagged)-Human lysophospholipase II (LYPLA2) 10 ug
$450.00
SC324073 LYPLA2 (untagged)-Human lysophospholipase II (LYPLA2) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.