OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPAR gamma (PPARG) (NM_138712) Human Mass Spec Standard

Be the first to review this product
SKU
PH301538
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408558 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PPAR gamma or NM_138712"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201538
Predicted MW 54.7 kDa
Protein Sequence
Protein Sequence
>RC201538 protein sequence
Red=Cloning site Green=Tags(s)

MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK
LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR
LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD
LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR
IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR
EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ
LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_619726
RefSeq Size 1892
RefSeq ORF 1431
Synonyms CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma
Locus ID 5468
UniProt ID P37231
Cytogenetics 3p25.2
Summary This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PPAR gamma" proteins (17)
SKU Description Size Price
PH312181 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) 10 ug
$3,360.00
PH312449 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) 10 ug
$3,360.00
PH312502 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) 10 ug
$3,360.00
LC402467 Lyophilized PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408558 Lyophilized PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408559 Lyophilized PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417568 Lyophilized PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430063 Lyophilized PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402467 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY408558 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY408559 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY417568 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY430063 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301538 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg 20 ug
$737.00
TP312181 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg 20 ug
$737.00
TP312449 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg 20 ug
$737.00
TP312502 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products