PPAR gamma (PPARG) (NM_138711) Human Recombinant Protein
SKU
TP312181
Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC212181 protein sequence
Red=Cloning site Green=Tags(s) MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_619725 |
Locus ID | 5468 |
UniProt ID | P37231 |
Cytogenetics | 3p25.2 |
RefSeq Size | 1919 |
RefSeq ORF | 1431 |
Synonyms | CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma |
Summary | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301538 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) | 10 ug |
$3,255.00
|
|
PH312181 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) | 10 ug |
$3,255.00
|
|
PH312449 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028) | 10 ug |
$3,255.00
|
|
PH312502 | PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) | 10 ug |
$3,255.00
|
|
LC402467 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC408558 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC408559 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417568 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC430063 | PPARG HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402467 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 | 100 ug |
$665.00
|
|
LY408558 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 | 100 ug |
$436.00
|
|
LY408559 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 | 100 ug |
$436.00
|
|
LY417568 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 | 100 ug |
$436.00
|
|
LY430063 | Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 | 100 ug |
$436.00
|
|
TP301538 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP312449 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP312502 | Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.