PPAR gamma (PPARG) (NM_005037) Human Mass Spec Standard

SKU
PH312449
PPARG MS Standard C13 and N15-labeled recombinant protein (NP_005028)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212449]
Predicted MW 54.7 kDa
Protein Sequence
Protein Sequence
>RC212449 protein sequence
Red=Cloning site Green=Tags(s)

MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLK
LQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIR
LKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESAD
LRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIR
IFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTR
EFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQ
LKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005028
RefSeq Size 1818
RefSeq ORF 1431
Synonyms CIMT1; GLM1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma
Locus ID 5468
UniProt ID P37231
Cytogenetics 3p25.2
Summary This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Huntington's disease, Pathways in cancer, PPAR signaling pathway, Thyroid cancer
Write Your Own Review
You're reviewing:PPAR gamma (PPARG) (NM_005037) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301538 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619726) 10 ug
$3,255.00
PH312181 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_619725) 10 ug
$3,255.00
PH312502 PPARG MS Standard C13 and N15-labeled recombinant protein (NP_056953) 10 ug
$3,255.00
LC402467 PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408558 PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408559 PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417568 PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430063 PPARG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402467 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2 100 ug
$665.00
LY408558 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3 100 ug
$436.00
LY408559 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 100 ug
$436.00
LY417568 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4 100 ug
$436.00
LY430063 Transient overexpression lysate of peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1 100 ug
$436.00
TP301538 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 1, 20 µg 20 ug
$737.00
TP312181 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 3, 20 µg 20 ug
$737.00
TP312449 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 4, 20 µg 20 ug
$737.00
TP312502 Recombinant protein of human peroxisome proliferator-activated receptor gamma (PPARG), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.