OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IRF5 (NM_032643) Human Mass Spec Standard

Be the first to review this product
SKU
PH300458
IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507252 IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7) 100 ul
$447.00
LY403185 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "IRF5 or NM_032643"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200458
Predicted MW 56 kDa
Protein Sequence
Protein Sequence
>RC200458 protein sequence
Red=Cloning site Green=Tags(s)

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF
RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE
ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC
ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW
PMHPAGMQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116032
RefSeq Size 2778
RefSeq ORF 1494
Synonyms SLEB10
Locus ID 3663
UniProt ID Q13568
Cytogenetics 7q32.1
Summary This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. provided by RefSeq, Dec 2016
Protein Families Transcription Factors
Protein Pathways Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IRF5" proteins (27)
SKU Description Size Price
PH311941 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) 10 ug
$3,360.00
PH312461 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) 10 ug
$3,360.00
PH315434 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) 10 ug
$3,360.00
PH315781 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) 10 ug
$3,360.00
PH316039 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) 10 ug
$3,360.00
PH316505 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) 10 ug
$3,360.00
LC403185 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419472 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420650 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420651 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420652 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420653 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420654 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403185 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419472 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY420650 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420651 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY420652 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY420653 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 (as WB positive control) 100 ug
$665.00
LY420654 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 (as WB positive control) 100 ug
$665.00
TP300458 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg 20 ug
$867.00
TP311941 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg 20 ug
$867.00
TP312461 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg 20 ug
$867.00
TP315434 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg 20 ug
$867.00
TP315781 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg 20 ug
$867.00
TP316039 Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg 20 ug
$867.00
TP316505 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

Diversity of interferon antagonist activities mediated by NSP1 proteins of different rotavirus strains
Arnold, Patton
J. Virol. (2011) 85 (5), 1970-9 DOI: 10.1128/JVI.01801-10
Cited by 20
AI Summary: OriGene’s pCMV6-XL5-β-TrCP plasmid was used as the template to amplify and construct a FLAG-tagged β-TrCP expression vector, enabling the study of NSP1-mediated degradation of β-TrCP in the investigation of rotavirus interferon antagonist activities.
Snippet: To construct the plasmid expressing FLAG-tagged β-TrCP, the sequence encoding β-TrCP (GenBank accession number NM_033637) was amplified from pCMV6-XL5-β-TrCP (OriGene) by using forward and reverse primers containing unique restriction sites (Table 1). The
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products