OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IRF5 (NM_001098631) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316039
Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA507252 IRF5 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IRF5 or NM_001098631"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216039 representing NM_001098631
Red=Cloning site Green=Tags(s)

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEP
GPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFG
PISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMF
SGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001092101
Locus ID 3663
UniProt ID Q13568
Cytogenetics 7q32.1
RefSeq Size 2741
RefSeq ORF 1464
Synonyms interferon regulatory factor 5; SLEB10
Summary This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. provided by RefSeq, Dec 2016
Protein Families Transcription Factors
Protein Pathways Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IRF5" proteins (27)
SKU Description Size Price
PH300458 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) 10 ug
$3,360.00
PH311941 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) 10 ug
$3,360.00
PH312461 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) 10 ug
$3,360.00
PH315434 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) 10 ug
$3,360.00
PH315781 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) 10 ug
$3,360.00
PH316039 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) 10 ug
$3,360.00
PH316505 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) 10 ug
$3,360.00
LC403185 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419472 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420650 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420651 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420652 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420653 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420654 Lyophilized IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403185 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419472 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY420650 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY420651 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 (as WB positive control) 100 ug
$665.00
LY420652 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY420653 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 (as WB positive control) 100 ug
$665.00
LY420654 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 (as WB positive control) 100 ug
$665.00
TP300458 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg 20 ug
$867.00
TP311941 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg 20 ug
$867.00
TP312461 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg 20 ug
$867.00
TP315434 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg 20 ug
$867.00
TP315781 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg 20 ug
$867.00
TP316505 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products