IRF5 (NM_001098631) Human Recombinant Protein
SKU
TP316039
Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC216039 representing NM_001098631
Red=Cloning site Green=Tags(s) MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEP GPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFG PISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMF SGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001092101 |
Locus ID | 3663 |
UniProt ID | Q13568 |
Cytogenetics | 7q32.1 |
RefSeq Size | 2741 |
RefSeq ORF | 1464 |
Synonyms | interferon regulatory factor 5; SLEB10 |
Summary | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016] |
Protein Families | Transcription Factors |
Protein Pathways | Toll-like receptor signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300458 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) | 10 ug |
$3,255.00
|
|
PH311941 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) | 10 ug |
$3,255.00
|
|
PH312461 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) | 10 ug |
$3,255.00
|
|
PH315434 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) | 10 ug |
$3,255.00
|
|
PH315781 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) | 10 ug |
$3,255.00
|
|
PH316039 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) | 10 ug |
$3,255.00
|
|
PH316505 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) | 10 ug |
$3,255.00
|
|
LC403185 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419472 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420650 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420651 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420652 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420653 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC420654 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426034 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403185 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 | 100 ug |
$436.00
|
|
LY419472 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 | 100 ug |
$665.00
|
|
LY420650 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 | 100 ug |
$665.00
|
|
LY420651 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 | 100 ug |
$665.00
|
|
LY420652 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 | 100 ug |
$665.00
|
|
LY420653 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 | 100 ug |
$665.00
|
|
LY420654 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 | 100 ug |
$665.00
|
|
TP300458 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP311941 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg | 20 ug |
$867.00
|
|
TP312461 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP315434 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP315781 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg | 20 ug |
$867.00
|
|
TP316505 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.