IRF5 (NM_001098627) Human Mass Spec Standard

SKU
PH315434
IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215434]
Predicted MW 55.9 kDa
Protein Sequence
Protein Sequence
>RC215434 representing NM_001098627
Red=Cloning site Green=Tags(s)

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEP
GPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFG
PISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMF
SGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092097
RefSeq Size 2870
RefSeq ORF 1464
Synonyms SLEB10
Locus ID 3663
UniProt ID Q13568
Cytogenetics 7q32.1
Summary This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016]
Protein Families Transcription Factors
Protein Pathways Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:IRF5 (NM_001098627) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300458 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) 10 ug
$3,255.00
PH311941 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) 10 ug
$3,255.00
PH312461 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) 10 ug
$3,255.00
PH315781 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) 10 ug
$3,255.00
PH316039 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101) 10 ug
$3,255.00
PH316505 IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) 10 ug
$3,255.00
LC403185 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419472 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420650 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420651 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420652 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420653 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420654 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426034 IRF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403185 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 100 ug
$436.00
LY419472 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 100 ug
$665.00
LY420650 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 100 ug
$665.00
LY420651 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 100 ug
$665.00
LY420652 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 100 ug
$665.00
LY420653 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 100 ug
$665.00
LY420654 Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 100 ug
$665.00
TP300458 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2, 20 µg 20 ug
$867.00
TP311941 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5, 20 µg 20 ug
$867.00
TP312461 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1, 20 µg 20 ug
$867.00
TP315434 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3, 20 µg 20 ug
$867.00
TP315781 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6, 20 µg 20 ug
$867.00
TP316039 Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7, 20 µg 20 ug
$867.00
TP316505 Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.