OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMB8 (NM_004159) Human Mass Spec Standard

Be the first to review this product
SKU
PH300353
PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_004150)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351358 Rabbit Polyclonal Anti-PSMB8 rabbit polyclonal antibody
100 ul
$205.00
LY407730 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PSMB8 or NM_004159"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200353
Predicted MW 29.6 kDa
Protein Sequence
Protein Sequence
>RC200353 representing NM_004159
Red=Cloning site Green=Tags(s)

MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTT
TLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGE
RISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSG
YRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004150
RefSeq Size 1602
RefSeq ORF 816
Synonyms ALDD; D6S216; D6S216E; JMP; LMP7; NKJO; PRAAS1; PSMB5i; RING10
Locus ID 5696
UniProt ID P28062
Cytogenetics 6p21.32
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMB8" proteins (7)
SKU Description Size Price
PH324611 PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_683720) 10 ug
$3,360.00
LC407730 Lyophilized PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418176 Lyophilized PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407730 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418176 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300353 Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, 20 µg 20 ug
$867.00
TP324611 Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products