PSMB8 (NM_004159) Human Tagged ORF Clone

SKU
RC200353
PSMB8 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMB8
Synonyms ALDD; D6S216; D6S216E; JMP; LMP7; NKJO; PRAAS1; PSMB5i; RING10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200353 representing NM_004159
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCATAGGAACCCCCACCCCGCGTGACACTACTCCCAGCTCCTGGCTGACTTCTAGTCTTCTGGTTG
AAGCTGCGCCTTTAGATGACACGACCCTACCCACCCCTGTTTCCAGCGGATGCCCGGGCCTGGAGCCCAC
AGAATTCTTCCAGTCCCTGGGTGGGGACGGAGAAAGGAACGTTCAGATTGAGATGGCCCATGGCACCACC
ACGCTCGCCTTCAAGTTCCAGCATGGAGTGATTGCAGCAGTGGATTCTCGGGCCTCAGCTGGGTCCTACA
TTAGTGCCTTACGGGTGAACAAGGTGATTGAGATTAACCCTTACCTGCTTGGCACCATGTCTGGCTGTGC
AGCAGACTGTCAGTACTGGGAGCGCCTGCTGGCCAAGGAATGCAGGCTGTACTATCTGCGAAATGGAGAA
CGTATTTCAGTGTCGGCAGCCTCCAAGCTGCTGTCCAACATGATGTGCCAGTACCGGGGCATGGGCCTCT
CTATGGGCAGTATGATCTGTGGCTGGGATAAGAAGGGTCCTGGACTCTACTACGTGGATGAACATGGGAC
TCGGCTCTCAGGAAATATGTTCTCCACGGGTAGTGGGAACACTTATGCCTACGGGGTCATGGACAGTGGC
TATCGGCCTAATCTTAGCCCTGAAGAGGCCTATGACCTTGGCCGCAGGGCTATTGCTTATGCCACTCACA
GAGACAGCTATTCTGGAGGCGTTGTCAATATGTACCACATGAAGGAAGATGGTTGGGTGAAAGTAGAAAG
TACAGATGTCAGTGACCTGCTGCACCAGTACCGGGAAGCCAATCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200353 representing NM_004159
Red=Cloning site Green=Tags(s)

MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTT
TLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGE
RISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSG
YRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004159
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004159.5
RefSeq Size 1602 bp
RefSeq ORF 819 bp
Locus ID 5696
UniProt ID P28062
Cytogenetics 6p21.32
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
MW 29.6 kDa
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:PSMB8 (NM_004159) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200353L1 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200353L2 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200353L3 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200353L4 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200353 PSMB8 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320228 PSMB8 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.