PSMB8 (NM_004159) Human Tagged ORF Clone
SKU
RC200353
PSMB8 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | PSMB8 |
Synonyms | ALDD; D6S216; D6S216E; JMP; LMP7; NKJO; PRAAS1; PSMB5i; RING10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC200353 representing NM_004159
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTCATAGGAACCCCCACCCCGCGTGACACTACTCCCAGCTCCTGGCTGACTTCTAGTCTTCTGGTTG AAGCTGCGCCTTTAGATGACACGACCCTACCCACCCCTGTTTCCAGCGGATGCCCGGGCCTGGAGCCCAC AGAATTCTTCCAGTCCCTGGGTGGGGACGGAGAAAGGAACGTTCAGATTGAGATGGCCCATGGCACCACC ACGCTCGCCTTCAAGTTCCAGCATGGAGTGATTGCAGCAGTGGATTCTCGGGCCTCAGCTGGGTCCTACA TTAGTGCCTTACGGGTGAACAAGGTGATTGAGATTAACCCTTACCTGCTTGGCACCATGTCTGGCTGTGC AGCAGACTGTCAGTACTGGGAGCGCCTGCTGGCCAAGGAATGCAGGCTGTACTATCTGCGAAATGGAGAA CGTATTTCAGTGTCGGCAGCCTCCAAGCTGCTGTCCAACATGATGTGCCAGTACCGGGGCATGGGCCTCT CTATGGGCAGTATGATCTGTGGCTGGGATAAGAAGGGTCCTGGACTCTACTACGTGGATGAACATGGGAC TCGGCTCTCAGGAAATATGTTCTCCACGGGTAGTGGGAACACTTATGCCTACGGGGTCATGGACAGTGGC TATCGGCCTAATCTTAGCCCTGAAGAGGCCTATGACCTTGGCCGCAGGGCTATTGCTTATGCCACTCACA GAGACAGCTATTCTGGAGGCGTTGTCAATATGTACCACATGAAGGAAGATGGTTGGGTGAAAGTAGAAAG TACAGATGTCAGTGACCTGCTGCACCAGTACCGGGAAGCCAATCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200353 representing NM_004159
Red=Cloning site Green=Tags(s) MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTT TLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGE RISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSG YRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004159 |
ORF Size | 816 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_004159.5 |
RefSeq Size | 1602 bp |
RefSeq ORF | 819 bp |
Locus ID | 5696 |
UniProt ID | P28062 |
Cytogenetics | 6p21.32 |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
MW | 29.6 kDa |
Summary | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC200353L1 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC200353L2 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RC200353L3 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC200353L4 | Lenti ORF clone of Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RG200353 | PSMB8 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC320228 | PSMB8 (untagged)-Human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.