OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMB8 (NM_148919) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324611
Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA351358 Rabbit Polyclonal Anti-PSMB8 rabbit polyclonal antibody
100 ul
$205.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PSMB8 or NM_148919"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224611 representing NM_148919
Red=Cloning site Green=Tags(s)

MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGDGERNVQIEMA
HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYL
RNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGV
MDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_683720
Locus ID 5696
UniProt ID P28062
Cytogenetics 6p21.32
RefSeq Size 1135
RefSeq ORF 828
Synonyms ALDD; D6S216; D6S216E; JMP; LMP7; NKJO; PRAAS1; PSMB5i; RING10
Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. provided by RefSeq, Jul 2008
Protein Categories Cytokines, Enzyme: Peptidases, Immune system diseases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMB8" proteins (7)
SKU Description Size Price
PH300353 PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_004150) 10 ug
$3,360.00
PH324611 PSMB8 MS Standard C13 and N15-labeled recombinant protein (NP_683720) 10 ug
$3,360.00
LC407730 Lyophilized PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418176 Lyophilized PSMB8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407730 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418176 Transient overexpression lysate of proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300353 Recombinant protein of human proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) (PSMB8), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products