OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPR56 (ADGRG1) (NM_005682) Human Mass Spec Standard

Be the first to review this product
SKU
PH300315
GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368429 ADGRG1 rabbit polyclonal antibody
100 ul
$310.00
LY428998 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 (as WB positive control) 100 ug
$665.00

Other products for "GPR56 or NM_005682"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200315
Predicted MW 77.7 kDa
Protein Sequence
Protein Sequence
>RC200315 protein sequence
Red=Cloning site Green=Tags(s)

MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP
FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV
TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ
SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR
SGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV
EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV
TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL
SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS
MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF
ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005673
RefSeq Size 3831
RefSeq ORF 2079
Synonyms BFPP; BPPR; GPR56; TM7LN4; TM7XN1
Locus ID 9289
UniProt ID Q9Y653
Cytogenetics 16q21
Summary This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2014
Protein Families Druggable Genome, GPCR, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GPR56" proteins (11)
SKU Description Size Price
PH318780 GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_958932) 10 ug
$3,360.00
PH326861 GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243) 10 ug
$3,360.00
LC401733 Lyophilized ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404437 Lyophilized ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428998 Lyophilized ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401733 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404437 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY428998 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP300315 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1, 20 µg 20 ug
$867.00
TP318780 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 2, 20 µg 20 ug
$867.00
TP326861 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products