GPR56 (ADGRG1) (NM_001145771) Human Mass Spec Standard

SKU
PH326861
GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_001139243)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226861]
Predicted MW 77.7 kDa
Protein Sequence
Protein Sequence
>RC226861 protein sequence
Red=Cloning site Green=Tags(s)

MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP
FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV
TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ
SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR
SGEAEKRLLLVDFSSQALFQDKNSSHVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV
EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV
TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL
SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS
MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF
ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139243
RefSeq Size 4269
RefSeq ORF 2079
Synonyms BFPP; BPPR; GPR56; TM7LN4; TM7XN1
Locus ID 9289
UniProt ID Q9Y653
Cytogenetics 16q21
Summary This gene encodes a member of the G protein-coupled receptor family and regulates brain cortical patterning. The encoded protein binds specifically to transglutaminase 2, a component of tissue and tumor stroma implicated as an inhibitor of tumor progression. Mutations in this gene are associated with a brain malformation known as bilateral frontoparietal polymicrogyria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Protein Families Druggable Genome, GPCR, Transmembrane
Write Your Own Review
You're reviewing:GPR56 (ADGRG1) (NM_001145771) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300315 GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_005673) 10 ug
$3,255.00
PH318780 GPR56 MS Standard C13 and N15-labeled recombinant protein (NP_958932) 10 ug
$3,255.00
LC401733 ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404437 ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428998 ADGRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401733 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 1 100 ug
$436.00
LY404437 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 2 100 ug
$665.00
LY428998 Transient overexpression lysate of G protein-coupled receptor 56 (GPR56), transcript variant 4 100 ug
$665.00
TP300315 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318780 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326861 Recombinant protein of human G protein-coupled receptor 56 (GPR56), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.