STUB1 (NM_005861) Human Mass Spec Standard

CAT#: PH300310

STUB1 MS Standard C13 and N15-labeled recombinant protein (NP_005852)

Product Images

Coomassie blue staining of purified STUB1 protein (Cat# TP300310). The protein was produced from HEK293T cells transfected with STUB1 cDNA clone (Cat# RC200310) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200310
• Predicted MW: 34.9 kDa
• Protein Sequence:
  Sequence Link

  >Peptide sequence encoded by RC200310
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
  YLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSA
  LRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKY
  MADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLT
  QEQLIPNLAMKEVIDAFISENGWVEDY
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC200310 also available, TP300310
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005852
• RefSeq Size: 1650
• RefSeq ORF: 909
• Synonyms: CHIP; HSPABP2; NY-CO-7; SCA48; SCAR16; SDCCAG7; UBOX1
• Locus ID: 10273
• UniProt ID: Q9UNE7
• Cytogenetics: 16p13.3
• Summary: This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2. [provided by RefSeq, Jun 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis