OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STUB1 (NM_005861) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200310
STUB1 (Myc-DDK-tagged)-Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA382159 STUB1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "STUB1 or NM_005861"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol STUB1
Synonyms CHIP; HSPABP2; NY-CO-7; SCA48; SCAR16; SDCCAG7; UBOX1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200310 representing NM_005861.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAAGGGCAAGGAGGAGAAGGAGGGCGGCGCACGGCTGGGCGCTGGCGGCGGAAGCCCCGAGAAGAGC
CCGAGCGCGCAGGAGCTCAAGGAGCAGGGCAATCGTCTGTTCGTGGGCCGAAAGTACCCGGAGGCGGCG
GCCTGCTACGGCCGCGCGATCACCCGGAACCCGCTGGTGGCCGTGTATTACACCAACCGGGCCTTGTGC
TACCTGAAGATGCAGCAGCACGAGCAGGCCCTGGCCGACTGCCGGCGCGCCCTGGAGCTGGACGGGCAG
TCTGTGAAGGCGCACTTCTTCCTGGGGCAGTGCCAGCTGGAGATGGAGAGCTATGATGAGGCCATCGCC
AATCTGCAGCGAGCTTACAGCCTGGCCAAGGAGCAGCGGCTGAACTTCGGGGACGACATCCCCAGCGCT
CTTCGAATCGCGAAGAAGAAGCGCTGGAACAGCATTGAGGAGCGGCGCATCCACCAGGAGAGCGAGCTG
CACTCCTACCTCTCCAGGCTCATTGCCGCGGAGCGTGAGAGGGAGCTGGAAGAGTGCCAGCGAAACCAC
GAGGGTGATGAGGACGACAGCCACGTCCGGGCCCAGCAGGCCTGCATTGAGGCCAAGCACGACAAGTAC
ATGGCGGACATGGACGAGCTTTTTTCTCAGGTGGATGAGAAGAGGAAGAAGCGAGACATCCCCGACTAC
CTGTGTGGCAAGATCAGCTTTGAGCTGATGCGGGAGCCGTGCATCACGCCCAGTGGCATCACCTACGAC
CGCAAGGACATCGAGGAGCACCTGCAGCGTGTGGGTCATTTTGACCCCGTGACCCGGAGCCCCCTGACC
CAGGAACAGCTCATCCCCAACTTGGCTATGAAGGAGGTTATTGACGCATTCATCTCTGAGAATGGCTGG
GTGGAGGACTAC
AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>Peptide sequence encoded by RC200310
Blue=ORF Red=Cloning site Green=Tag(s)

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
YLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSA
LRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKY
MADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLT
QEQLIPNLAMKEVIDAFISENGWVEDY
SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC200310 also available, TP300310
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_005861
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005861.4
RefSeq Size 1650 bp
RefSeq ORF 912 bp
Locus ID 10273
UniProt ID Q9UNE7
Cytogenetics 16p13.3
Domains TPR, U-box
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
MW 34.9 kDa
Summary This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2. provided by RefSeq, Jun 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005861" in other vectors (6)
SKU Description Size Price
RC200310L1 Lenti ORF clone of Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1), Myc-DDK-tagged 10 ug
$600.00
RC200310L2 Lenti ORF clone of Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1), mGFP tagged 10 ug
$600.00
RC200310L3 Lenti ORF clone of Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1), Myc-DDK-tagged 10 ug
$600.00
RC200310L4 Lenti ORF clone of Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1), mGFP tagged 10 ug
$600.00
RG200310 STUB1 (tGFP-tagged) - Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1) 10 ug
$489.00 $500.00
SC319337 STUB1 (untagged)-Human STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1) 10 ug
$300.00

Plasmid Map for RC200310

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200310
Circular map for RC200310

file-alt Citations

Diptoindonesin G antagonizes AR signaling and enhances the efficacy of antiandrogen therapy in prostate cancer
Mao, Kong, Liu et al
Prostate (2022) 82 (8), 917-932 DOI: 10.1002/pros.24336
Cited by 3
AI Summary: OriGene’s CMV6-Myc-DDK-CHIP plasmid (RC200310) was used in this study to investigate the role of CHIP E3 ligase in Diptoindonesin G-mediated degradation of androgen receptor and PLK1 in prostate cancer cells.
Snippet: Background The androgen receptor (AR) signaling pathway has been well demonstrated to play a crucial role in the development, progression, and drug resistance of Save;CMV6-Myc-DDK-CHIP was purchased from Origene (RC200310)
Zinc deficiency causes neural tube defects through attenuation of p53 ubiquitylation
Li, Zhang, Niswander
Development (2018) 145 (24) DOI: 10.1242/dev.169797
AI Summary: OriGene products, including the DDK (FLAG OTI4C5) antibody (TA50011), TP53-Myc-DDK-tagged plasmid (RC200003), and STUB1-Myc-DDK-tagged plasmid (RC200310), were used for protein detection and to overexpress human p53 and CHIP in cell culture experiments, enabling the study of zinc deficiency effects on neural tube closure and p53 regulation.
Snippet: Mdm2 (SMP14) (1:50;sc-965;Santa Cruz);Chip (C3B6) (1:500;2080;Cell Signaling Technology);ubiquitin (1:500;3933;DDK (FLAG OTI4C5) (1:2000;TA50011;Origene) ... To reintroduce p53 or overexpress CHIP protein, NE-4C cells or E9.5 primary neuroepithelial cells were subjected to transient transfection. Plasmids containing the coding region of human p53 (TP53-Myc-DDK-tagged) (RC200003, Origene) or human CHIP protein (STUB1-Myc-DDK-tagged) (RC200310, Origene) were transfected into cells using Xfect Transfection Reagent (Clontech) according to the manufacturer's protocol (1.5?g or 2.5?g plasmid for transfection per well of a 12-well plate;0.5 or 1?g for 24-well plate). …
Latent Membrane Protein 1 of Epstein-Barr Virus Promotes RIG-I Degradation Mediated by Proteasome Pathway
Xu, Sun, Liu et al
Front Immunol (2018) 9, 1446 DOI: 10.3389/fimmu.2018.01446
AI Summary: OriGene products, specifically the TRAFD1 (RC200265) and CHIP (RC200310) plasmids, were used in this study to investigate the molecular mechanisms by which EBV's LMP1 protein promotes RIG-I degradation via the proteasome pathway.
Snippet: The promoter luciferase reporter plasmids IFN-β-Luc, NF-kB-Luc, IFN-stimulated response element (ISRE)-Luc, and expression plasmids RIG-I, RIG-IN, MDA5C, MAVS, TBK1, IRF3/5D were provided by Liu W (22) (Chinese Academy of Sciences, China). Plasmids TRAFD1 (RC200265) and CHIP (RC200310) were products of OriGene company
FigureFigureFigure
Mass spectrometry analyses of normal and polyglutamine expanded ataxin-3 reveal novel interaction partners involved in mitochondrial function
Kristensen, Oppermann, Rauen et al
Neurochem Int (2018) 112, 5-17 DOI: 10.1016/j.neuint.2017.10.013
Cited by 24
AI Summary: OriGene products contributed to this study by providing the Myc-DDK-tagged ataxin-3 expression plasmids (OriGene, Cat# RC208706 and RC208707), which were used to express normal and polyglutamine-expanded ataxin-3 for protein interaction and mass spectrometry analyses.
Mass spectrometry analyses of normal and polyglutamine expanded ataxin-3 reveal novel interaction partners involved in mitochondrial function
Kristensen, Oppermann, Rauen et al
Neurochemistry International (2017)
AI Summary: OriGene products CHIP-Myc-FLAG (RC200310), HSPA1A-Myc-FLAG (RC200270), BAG-1-Myc-FLAG (RC201272), and Hip-Myc-FLAG (RC220533) in pcMV6 vectors were used in this study to investigate protein interactions related to mitochondrial function in ataxin-3.
Snippet: Denmark). CHIP-Myc-FLAG (RC200310), HSPA1A-Myc-FLAG (RC200270), BAG-1-Myc-FLAG (RC201272), and Hip-Myc-FLAG (RC220533) all in pcMV6 vector, were purchased from Origene (Origene Technologies, USA);... Denmark). CHIP-Myc-FLAG (RC200310), HSPA1A-Myc-FLAG (RC200270), BAG-1-Myc-FLAG (RC201272), and Hip-Myc-FLAG (RC220533) all in pcMV6 vector, were purchased from Origene (Origene Technologies, USA).
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products