STUB1 (NM_005861) Human Recombinant Protein

SKU
TP300310
Recombinant protein of human STIP1 homology and U-box containing protein 1 (STUB1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC200310
Blue=ORF Red=Cloning site Green=Tag(s)

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
YLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSA
LRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKY
MADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLT
QEQLIPNLAMKEVIDAFISENGWVEDY

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC200310 also available, TP300310
Tag C-Myc/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005852
Locus ID 10273
UniProt ID Q9UNE7
Cytogenetics 16p13.3
RefSeq Size 1650
RefSeq ORF 909
Synonyms CHIP; HSPABP2; NY-CO-7; SCA48; SCAR16; SDCCAG7; UBOX1
Summary This gene encodes a protein containing tetratricopeptide repeat and a U-box that functions as a ubiquitin ligase/cochaperone. The encoded protein binds to and ubiquitinates shock cognate 71 kDa protein (Hspa8) and DNA polymerase beta (Polb), among other targets. Mutations in this gene cause spinocerebellar ataxia, autosomal recessive 16. Alternative splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 2. [provided by RefSeq, Jun 2014]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:STUB1 (NM_005861) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300310 STUB1 MS Standard C13 and N15-labeled recombinant protein (NP_005852) 10 ug
$3,255.00
LC417031 STUB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417031 Transient overexpression lysate of STIP1 homology and U-box containing protein 1 (STUB1) 100 ug
$436.00
TP720096 Recombinant protein of human STIP1 homology and U-box containing protein 1 (STUB1) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.