VPS28 (NM_016208) Human Mass Spec Standard

CAT#: PH300025

VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292)

Product Images

Coomassie blue staining of purified VPS28 protein (Cat# TP300025). The protein was produced from HEK293T cells transfected with VPS28 cDNA clone (Cat# RC200025) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200025
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200025 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
  SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM
  DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES
  AYNAFNRFLHA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057292
• RefSeq Size: 994
• RefSeq ORF: 663
• Locus ID: 51160
• UniProt ID: Q9UK41, Q548N1
• Cytogenetics: 8q24.3
• Summary: This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
• Protein Pathways: Endocytosis