VPS28 (NM_016208) Human Recombinant Protein

SKU
TP300025
Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200025 protein sequence
Red=Cloning site Green=Tags(s)

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES
AYNAFNRFLHA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057292
Locus ID 51160
UniProt ID Q9UK41
Cytogenetics 8q24.3
RefSeq Size 994
RefSeq ORF 663
Summary This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:VPS28 (NM_016208) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300025 VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292) 10 ug
$3,255.00
PH308726 VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880) 10 ug
$3,255.00
LC405220 VPS28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414122 VPS28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405220 Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 100 ug
$436.00
LY414122 Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 100 ug
$436.00
TP308726 Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761364 Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.