VPS28 (NM_183057) Human Mass Spec Standard

SKU
PH308726
VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208726]
Predicted MW 26.5 kDa
Protein Sequence
Protein Sequence
>RC208726 protein sequence
Red=Cloning site Green=Tags(s)

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWWVSLPARQSPAVPETLPARRSPAVPLR
PSAPTCPVLHSQAADPERHVGVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_898880
RefSeq Size 1112
RefSeq ORF 699
Locus ID 51160
UniProt ID Q9UK41
Cytogenetics 8q24.3
Summary This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:VPS28 (NM_183057) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300025 VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292) 10 ug
$3,255.00
LC405220 VPS28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414122 VPS28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405220 Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 100 ug
$436.00
LY414122 Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 100 ug
$436.00
TP300025 Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP308726 Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761364 Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.