OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

M1 (NC_002016) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC102473
Myc-DDK-tagged ORF clone of viral ORF for matrix protein 1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))], codon optimized for human cell expression, NP_040978
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "M1 or NC_002016"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol M1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102473 represents NCBI reference of NP_040978 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTTCTGACCGAGGTGGAGACCTATGTGCTCTCAATTATCCCCTCAGGGCCTCTGAAAGCTGAAA
TTGCACAGCGGCTCGAGGACGTGTTTGCGGGAAAGAATACCGACCTGGAGGTTCTGATGGAATGGCTGAA
AACGAGGCCCATTCTCAGTCCCCTGACGAAGGGCATCCTGGGATTTGTTTTTACTCTTACTGTGCCCTCA
GAACGGGGCCTGCAAAGAAGGAGATTTGTACAGAACGCACTCAACGGTAACGGCGACCCAAACAACATGG
ACAAAGCCGTTAAGCTGTACCGAAAACTGAAAAGGGAAATTACCTTTCACGGCGCTAAAGAGATATCTCT
CAGCTACTCTGCAGGGGCACTGGCATCATGCATGGGTCTCATTTATAATCGCATGGGAGCTGTCACCACC
GAGGTGGCTTTCGGATTGGTGTGTGCTACATGCGAGCAGATCGCCGACTCCCAGCACCGCTCCCATAGAC
AGATGGTAACAACTACAAATCCCCTGATTCGCCATGAGAATCGCATGGTACTTGCTTCTACAACTGCCAA
AGCAATGGAACAGATGGCCGGCTCCAGCGAGCAAGCCGCAGAGGCGATGGAAGTGGCCAGCCAAGCAAGA
CAGATGGTGCAGGCAATGCGAACAATTGGGACACACCCCTCTTCTAGTGCTGGCCTTAAGAACGATCTGC
TCGAGAATCTGCAGGCCTACCAGAAGAGAATGGGAGTGCAGATGCAGAGATTCAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC102473 representing NP_040978
Red=Cloning sites Green=Tags

MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPS
ERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTT
EVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQAR
QMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_002016
ORF Size 756 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_002016.1, NP_040978
RefSeq ORF 756 bp
Locus ID 956527
MW 27.9 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_002016" in other vectors (1)
SKU Description Size Price
VC102474 Myc-DDK-tagged ORF clone of viral ORF for matrix protein 2 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))], codon optimized for human cell expression, NP_040979 10 ug
$225.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products