OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

middle S protein (NC_003977) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC102197
Myc-DDK-tagged ORF clone of viral ORF for middle S protein [Hepatitis B virus], codon optimized for human cell expression, YP_355334
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "middle S protein or NC_003977"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol middle S protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102197 represents NCBI reference of YP_355334 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTGGAATTCAACAACTTTTCACCAGGCCCTGCTGGACCCACGGGTGAGAGGTCTCTATTTTCCGG
CCGGTGGCAGCTCCTCAGGAACTGTTAATCCCGTTCCTACTACGGCCAGTCCTATCTCCAGCATCTTCTC
TAGGACCGGGGATCCTGCACCGAACATGGAGTCCACGACATCCGGTTTTCTGGGGCCTCTGTTGGTGCTT
CAGGCAGGCTTTTTCCTTCTTACGCGAATTCTCACAATCCCGCAGTCATTGGATAGCTGGTGGACCTCCC
TCAACTTCCTCGGGGGCGCCCCCACATGCCCTGGACAGAATTCTCAGAGCCCTACGTCAAATCACAGTCC
CACGTCTTGCCCACCCACGTGTCCAGGCTACAGATGGATGTGTCTCCGCCGCTTTATAATTTTCCTTTTT
ATCCTCCTCCTCTGCCTTATTTTCCTGCTTGTGCTGCTCGACTATCAGGGAATGCTGCCCGTGTGCCCAC
TTCTCCCTGGAACTTCAACCACCTCCACCGGACCCTGCCGAACCTGTACTATCCCTGCTCAGGGGACTTC
TATGTTCCCTAGTTGCTGCTGCACAAAACCTTCCGACGGCAACTGTACCTGTATTCCTATCCCCAGTAGT
TGGGCCTTCGCCAGATTTCTGTGGGAATGGGCGTCTGTGCGCTTTTCCTGGCTGTCCCTGTTGGTCCCTT
TCGTCCAGTGGTTCGTAGGGTTGTCTCCAACAGTTTGGCTTAGTGCAATCTGGATGATGTGGTATTGGGG
TCCAAGCTTGTATAACATACTCTCTCCCTTCTTGCCACTGCTGCCTATTTTTTTCTGCTTGTGGGTGTAC
ATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC102197 representing YP_355334
Red=Cloning sites Green=Tags

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVL
QAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLF
ILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSS
WAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVY
I

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_003977
ORF Size 843 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_003977.1, YP_355334
RefSeq ORF 843 bp
Locus ID 944569
MW 31.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_003977" in other vectors (6)
SKU Description Size Price
VC102192 Myc-DDK-tagged ORF clone of viral ORF for Polymerase [Hepatitis B virus], codon optimized for human cell expression, NP_647604 10 ug
$1,158.00
VC102193 Myc-DDK-tagged ORF clone of viral ORF for S protein [Hepatitis B virus], codon optimized for human cell expression, NP_647605 10 ug
$450.00
VC102194 Myc-DDK-tagged ORF clone of viral ORF for X protein [Hepatitis B virus], codon optimized for human cell expression, NP_647606 10 ug
$225.00
VC102195 Myc-DDK-tagged ORF clone of viral ORF for Core and e antigen [Hepatitis B virus], codon optimized for human cell expression, NP_647607 10 ug
$450.00
VC102196 Myc-DDK-tagged ORF clone of viral ORF for large S protein [Hepatitis B virus], codon optimized for human cell expression, YP_355333 10 ug
$686.00
VC102198 Myc-DDK-tagged ORF clone of viral ORF for precore/core protein [Hepatitis B virus], codon optimized for human cell expression, YP_355335 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products