OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C' (NC_003461) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC102043
Myc-DDK-tagged ORF clone of viral ORF for C' protein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604434
  $330.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "C' or NC_003461"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol C'
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102043 represents NCBI reference of NP_604434 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACTAGCGCCTCCAAGACCCTCCTTCCAGAGTGGATACGCATGCCTAGCTTTCTCAGAGGGATCC
TCAAACCCAAGGAGCGCCATCACGAAAATAAGAACCACTCACAGATGTCCTCAGATTCACTGACGTCCAG
CTACCCTACCTCTCCTCAGAAACTGGAGAAGACTGAGGCCGGGAGCATGGTTAGCTCCACCACCCAGAAG
AAGACATCACACCACGCCAAGCCCACTATTACCACCAAGACAGAACAATCTCAGCGCCGCCCGAAAATTA
TAGATCAGGTGCGGGGGGTAGAATCACTGGGTGAACAAGTTTCCCAGAAGCAGAGGCACATGCTCGAGAG
CCTCATTAACAAAGTATACACCGGTCCTCTGGGGGAGGAGCTGGTCCAAACCCTTTACCTCAGAATATGG
GCTATGAAGGAGACCCCAGAAAGTACTAAAATCCTCCAAATGCGCGAAGATATTAGGGATCAGTACCTGC
GGATGAAGACAGAGCGCTGGCTTCGAACTCTGATAAGGGGGAAAAAGACAAAGCTCAGGGATTTTCAGAA
GCGCTATGAGGAAGTGCATCCCTACCTGATGATGGAGCGCGTGGAACAGATAATTATGGAAGAGGCCTGG
AAACTCGCTGCCCACATTGTCCAGGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC102043 representing NP_604434
Red=Cloning sites Green=Tags

MDTSASKTLLPEWIRMPSFLRGILKPKERHHENKNHSQMSSDSLTSSYPTSPQKLEKTEAGSMVSSTTQK
KTSHHAKPTITTKTEQSQRRPKIIDQVRGVESLGEQVSQKQRHMLESLINKVYTGPLGEELVQTLYLRIW
AMKETPESTKILQMREDIRDQYLRMKTERWLRTLIRGKKTKLRDFQKRYEEVHPYLMMERVEQIIMEEAW
KLAAHIVQE

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_003461
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_003461.1, NP_604434
RefSeq ORF 657 bp
Locus ID 935259
MW 25.8 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_003461" in other vectors (8)
SKU Description Size Price
VC102042 Myc-DDK-tagged ORF clone of viral ORF for nucleoprotein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604433 10 ug
$537.00
VC102044 Myc-DDK-tagged ORF clone of viral ORF for phosphoprotein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604435 10 ug
$582.00
VC102045 Myc-DDK-tagged ORF clone of viral ORF for C protein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604436 10 ug
$450.00
VC102046 Myc-DDK-tagged ORF clone of viral ORF for Y1 protein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604437 10 ug
$330.00
VC102047 Myc-DDK-tagged ORF clone of viral ORF for putative Y2 protein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604438 10 ug
$330.00
VC102048 Myc-DDK-tagged ORF clone of viral ORF for matrix protein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604439 10 ug
$503.00
VC102049 Myc-DDK-tagged ORF clone of viral ORF for F glycoprotein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604440 10 ug
$289.00 $517.00
VC102050 Myc-DDK-tagged ORF clone of viral ORF for HN glycoprotein [Human parainfluenza virus 1], codon optimized for human cell expression, NP_604441 10 ug
$589.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products