OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

E4 (NC_001405) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100403
Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf2 [Human adenovirus C], codon optimized for human cell expression, YP_001551774
  $165.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "E4 or NC_001405"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100403 represents NCBI reference of YP_001551774 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCGAGAGAAAGATGGTATCATTTTCCGTCGTCGTACCCGAGTTGACCTGCCTGTACCTGCATGAAC
ATGATTACGACGTCCTGGCCTTTCTTAGGGAAGCCCTCCCTGATTTTCTCTCAAGTACATTGCACTTTAT
CAGCCCACCGATGCAGCAGGCATATATTGGGGCCACTCTCGTATCTATTGCCCCTTCTATGCGGGTGATT
ATCTCCGTCGGCTCTTTTGTAATGGTTCCAGGCGGCGAAGTCGCAGCACTTGTGCGGGCAGATCTGCATG
ACTATGTGCAGCTGGCGCTCAGGAGGGATCTGCGCGATAGGGGCATCTTTGTTAATGTTCCTCTGCTCAA
TCTGATACAGGTATGCGAAGAGCCCGAGTTCTTGCAGAGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100403 representing YP_001551774
Red=Cloning sites Green=Tags

MFERKMVSFSVVVPELTCLYLHEHDYDVLAFLREALPDFLSSTLHFISPPMQQAYIGATLVSIAPSMRVI
ISVGSFVMVPGGEVAALVRADLHDYVQLALRRDLRDRGIFVNVPLLNLIQVCEEPEFLQS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_001405
ORF Size 390 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001405.1, YP_001551774
RefSeq ORF 390 bp
Locus ID 2652989
MW 14.6 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_001405" in other vectors (36)
SKU Description Size Price
VC100367 Myc-DDK-tagged ORF clone of viral ORF for control protein E1A [Human adenovirus C], codon optimized for human cell expression, NP_040507 10 ug
$330.00
VC100368 Myc-DDK-tagged ORF clone of viral ORF for control protein E1A 243R [Human adenovirus C], codon optimized for human cell expression, NP_040508 10 ug
$330.00
VC100369 Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 19K [Human adenovirus C], codon optimized for human cell expression, NP_040510 10 ug
$330.00
VC100370 Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 55K [Human adenovirus C], codon optimized for human cell expression, NP_040511 10 ug
$503.00
VC100371 Myc-DDK-tagged ORF clone of viral ORF for capsid protein IX [Human adenovirus C], codon optimized for human cell expression, NP_040514 10 ug
$165.00
VC100372 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein IVa2 [Human adenovirus C], codon optimized for human cell expression, NP_040515 10 ug
$503.00
VC100373 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human adenovirus C], codon optimized for human cell expression, NP_040516 10 ug
$1,147.00
VC100374 Myc-DDK-tagged ORF clone of viral ORF for protein 136K [Human adenovirus C], codon optimized for human cell expression, NP_040517 10 ug
$165.00
VC100375 Myc-DDK-tagged ORF clone of viral ORF for terminal protein precursor pTP [Human adenovirus C], codon optimized for human cell expression, NP_040518 10 ug
$676.00
VC100376 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 52K [Human adenovirus C], codon optimized for human cell expression, NP_040519 10 ug
$503.00
VC100378 Myc-DDK-tagged ORF clone of viral ORF for penton base [Human adenovirus C], codon optimized for human cell expression, NP_040521 10 ug
$585.00
VC100379 Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pVII [Human adenovirus C], codon optimized for human cell expression, NP_040522 10 ug
$330.00
VC100380 Myc-DDK-tagged ORF clone of viral ORF for core protein V [Human adenovirus C], codon optimized for human cell expression, NP_040523 10 ug
$503.00
VC100381 Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pX [Human adenovirus C], codon optimized for human cell expression, YP_001551766 10 ug
$165.00
VC100382 Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVI [Human adenovirus C], codon optimized for human cell expression, NP_040524 10 ug
$330.00
VC100383 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus C], codon optimized for human cell expression, NP_040525 10 ug
$975.00
VC100384 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus C], codon optimized for human cell expression, NP_040526 10 ug
$330.00
VC100385 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human adenovirus C], codon optimized for human cell expression, NP_040527 10 ug
$542.00
VC100386 Myc-DDK-tagged ORF clone of viral ORF for hexon assembly protein 100K [Human adenovirus C], codon optimized for human cell expression, NP_040528 10 ug
$811.00
VC100387 Myc-DDK-tagged ORF clone of viral ORF for protein 33K [Human adenovirus C], codon optimized for human cell expression, NP_040529 10 ug
$330.00
VC100388 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 22K [Human adenovirus C], codon optimized for human cell expression, YP_001551767 10 ug
$330.00
VC100389 Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVIII [Human adenovirus C], codon optimized for human cell expression, NP_040530 10 ug
$330.00
VC100390 Myc-DDK-tagged ORF clone of viral ORF for control protein E3 125K [Human adenovirus C], codon optimized for human cell expression, YP_001551768 10 ug
$165.00
VC100391 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-alpha [Human adenovirus C], codon optimized for human cell expression, YP_001551769 10 ug
$165.00
VC100392 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 gp19K [Human adenovirus C], codon optimized for human cell expression, NP_040531 10 ug
$165.00
VC100393 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-beta [Human adenovirus C], codon optimized for human cell expression, NP_040532 10 ug
$165.00
VC100394 Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-alpha [Human adenovirus C], codon optimized for human cell expression, YP_001551770 10 ug
$165.00
VC100395 Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-beta [Human adenovirus C], codon optimized for human cell expression, YP_001551771 10 ug
$165.00
VC100396 Myc-DDK-tagged ORF clone of viral ORF for control protein E3 147K [Human adenovirus C], codon optimized for human cell expression, NP_597753 10 ug
$165.00
VC100397 Myc-DDK-tagged ORF clone of viral ORF for protein U, partial [Human adenovirus C], codon optimized for human cell expression, NP_597754 10 ug
$165.00
VC100398 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus C], codon optimized for human cell expression, NP_040533 10 ug
$596.00
VC100399 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf6/7 [Human adenovirus C], codon optimized for human cell expression, YP_001551772 10 ug
$165.00
VC100400 Myc-DDK-tagged ORF clone of viral ORF for control protein E4 34K [Human adenovirus C], codon optimized for human cell expression, NP_597755 10 ug
$330.00
VC100401 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf4 [Human adenovirus C], codon optimized for human cell expression, YP_001551773 10 ug
$165.00
VC100402 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf3 [Human adenovirus C], codon optimized for human cell expression, NP_040534 10 ug
$165.00
VC100404 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf1 [Human adenovirus C], codon optimized for human cell expression, NP_597756 10 ug
$225.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products