OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

E4 (NC_011202) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100324
Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf4 [Human adenovirus B], codon optimized for human cell expression, YP_002213848
  $165.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "E4 or NC_011202"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100324 represents NCBI reference of YP_002213848 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTGCCTTCTTTGCCCTCCCCTCTCCTTCTGGAGACTCAGAGTAGCTGTATTGCGTGGCTTGGCT
TTGCCTATGCCACCGTCGACGATTTTCTGCGCACAATCCGCTGTGACGGAGTATTGATCACGACCGAAGC
TTCTATCCTGCTCACCAATCTCAGAGTTTGGTTGTACCTGAATTATCACACTGAGCATGCCAAGCGGCAG
GACAGGAGGAGACGGCGCGTCTGTAGCGCACGAGCTGCCTTCTGCTACACCAAGTATGAAAACGTGAGAA
AACAGTTGCACTACGATAAGGTTGCCCGGACATTGGATATCATGCGCCAGACATCCCCATTGCACCAGTC
ACCAGTGACTACCCTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100324 representing YP_002213848
Red=Cloning sites Green=Tags

MVLPSLPSPLLLETQSSCIAWLGFAYATVDDFLRTIRCDGVLITTEASILLTNLRVWLYLNYHTEHAKRQ
DRRRRRVCSARAAFCYTKYENVRKQLHYDKVARTLDIMRQTSPLHQSPVTTL

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_011202
ORF Size 366 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_011202.1, YP_002213848
RefSeq ORF 366 bp
Locus ID 6870513
MW 14.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_011202" in other vectors (37)
SKU Description Size Price
VC100290 Myc-DDK-tagged ORF clone of viral ORF for control protein E1A [Human adenovirus B], codon optimized for human cell expression, YP_002213798 10 ug
$330.00
VC100291 Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 19K [Human adenovirus B], codon optimized for human cell expression, YP_002213799 10 ug
$330.00
VC100292 Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 55K [Human adenovirus B], codon optimized for human cell expression, YP_002213800 10 ug
$503.00
VC100293 Myc-DDK-tagged ORF clone of viral ORF for capsid protein IX [Human adenovirus B], codon optimized for human cell expression, YP_002213801 10 ug
$165.00
VC100294 Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human adenovirus B], codon optimized for human cell expression, YP_002213842 10 ug
$1,142.00
VC100295 Myc-DDK-tagged ORF clone of viral ORF for terminal protein precursor pTP [Human adenovirus B], codon optimized for human cell expression, YP_002213843 10 ug
$672.00
VC100296 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein IVa2 [Human adenovirus B], codon optimized for human cell expression, YP_002213841 10 ug
$503.00
VC100297 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus B], codon optimized for human cell expression, YP_002213828 10 ug
$330.00
VC100298 Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVIII [Human adenovirus B], codon optimized for human cell expression, YP_002213818 10 ug
$330.00
VC100299 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 22K [Human adenovirus B], codon optimized for human cell expression, YP_002213817 10 ug
$330.00
VC100300 Myc-DDK-tagged ORF clone of viral ORF for protein 33K [Human adenovirus B], codon optimized for human cell expression, YP_002213816 10 ug
$330.00
VC100301 Myc-DDK-tagged ORF clone of viral ORF for hexon assembly protein 100K [Human adenovirus B], codon optimized for human cell expression, YP_002213815 10 ug
$818.00
VC100302 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus B], codon optimized for human cell expression, YP_002213813 10 ug
$330.00
VC100303 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus B], codon optimized for human cell expression, YP_002213812 10 ug
$955.00
VC100304 Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVI [Human adenovirus B], codon optimized for human cell expression, YP_002213811 10 ug
$330.00
VC100305 Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pX [Human adenovirus B], codon optimized for human cell expression, YP_002213810 10 ug
$165.00
VC100306 Myc-DDK-tagged ORF clone of viral ORF for core protein V [Human adenovirus B], codon optimized for human cell expression, YP_002213809 10 ug
$503.00
VC100307 Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pVII [Human adenovirus B], codon optimized for human cell expression, YP_002213808 10 ug
$330.00
VC100308 Myc-DDK-tagged ORF clone of viral ORF for penton base [Human adenovirus B], codon optimized for human cell expression, YP_002213807 10 ug
$574.00
VC100309 Myc-DDK-tagged ORF clone of viral ORF for protein 136K [Human adenovirus B], codon optimized for human cell expression, YP_002213804 10 ug
$165.00
VC100310 Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pIIIa [Human adenovirus B], codon optimized for human cell expression, YP_002213806 10 ug
$601.00
VC100311 Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 52K [Human adenovirus B], codon optimized for human cell expression, YP_002213805 10 ug
$503.00
VC100312 Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human adenovirus B], codon optimized for human cell expression, YP_002213852 10 ug
$530.00
VC100313 Myc-DDK-tagged ORF clone of viral ORF for control protein E3 125K [Human adenovirus B], codon optimized for human cell expression, YP_002213819 10 ug
$165.00
VC100314 Myc-DDK-tagged ORF clone of viral ORF for control protein E3 147K [Human adenovirus B], codon optimized for human cell expression, YP_002213826 10 ug
$165.00
VC100315 Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-beta [Human adenovirus B], codon optimized for human cell expression, YP_002213825 10 ug
$165.00
VC100316 Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-alpha [Human adenovirus B], codon optimized for human cell expression, YP_002213824 10 ug
$165.00
VC100317 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-gamma [Human adenovirus B], codon optimized for human cell expression, YP_002213823 10 ug
$330.00
VC100318 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-beta [Human adenovirus B], codon optimized for human cell expression, YP_002213822 10 ug
$330.00
VC100319 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 gp19K [Human adenovirus B], codon optimized for human cell expression, YP_002213821 10 ug
$165.00
VC100320 Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-alpha [Human adenovirus B], codon optimized for human cell expression, YP_002213820 10 ug
$165.00
VC100321 Myc-DDK-tagged ORF clone of viral ORF for protein U, partial [Human adenovirus B], codon optimized for human cell expression, YP_002213845 10 ug
$165.00
VC100322 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf6/7 [Human adenovirus B], codon optimized for human cell expression, YP_002213846 10 ug
$165.00
VC100323 Myc-DDK-tagged ORF clone of viral ORF for control protein E4 34K [Human adenovirus B], codon optimized for human cell expression, YP_002213847 10 ug
$330.00
VC100325 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf3 [Human adenovirus B], codon optimized for human cell expression, YP_002213849 10 ug
$165.00
VC100326 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf2 [Human adenovirus B], codon optimized for human cell expression, YP_002213850 10 ug
$165.00
VC100327 Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf1 [Human adenovirus B], codon optimized for human cell expression, YP_002213851 10 ug
$289.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products