OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

L3 (NC_001460) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC100267
Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040923
  $330.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "L3 or NC_001460"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol L3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC100267 represents NCBI reference of NP_040923 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGATATAAATTTTTCTAGTCTGGCTCCACGGCATGGCACACGGCCCTACATGGGCACCTGGAACG
AAATTGGAACGTCTCAGCTGAATGGGGGCGCCTTCAATTGGAACTCTATCTGGAGCGGGCTGAAAAATTT
TGGAAGCACTATCAAAACCTACGGCACCAAAGCGTGGAACTCACAGACAGGTCAGATGTTGAGGGACAAA
CTGAAAGATCAGAACTTCCAGCAGAAAGTCGTGGATGGGCTTGCCTCAGGCATCAACGGCGTCGTCGATA
TTGCAAACCAGGCTGTGCAAAAGAAGATCGCAAACCGCCTTGAGCCCCGCCCTGACGAAGTTATGGTCGA
AGAGAAGCTGCCACCACTGGAAACTGTTCCTGGATCAGTGCCCACCAAGGGTGAAAAGCGGCCCAGGCCC
GACGCCGAGGAGACGCTGGTGACCCACACGACGGAGCCACCCAGCTACGAAGAGGCTATAAAACAGGGTG
CTGCATTGTCCCCGACCACATACCCAATGACCAAGCCAATTCTGCCCATGGCGACTAGGGTTTATGGCAA
AAATGAAAACGTGCCCATGACTCTCGAGCTCCCACCTCTTCCAGAGCCTACAATCGCCGACCCTGTAGGT
AGCGTACCTGTCGCTAGCGTTCCTGTGGCCAGTACCGTCTCCAGGCCTGCTGTGCGCCCAGTAGCGGTCG
CCAGCCTGAGAAACCCAAGATCTTCTAATTGGCAATCAACTCTTAATAGCATCGTGGGCCTGGGCGTTAA
GTCACTTAAGCGGCGGAGGTGCTAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100267 representing NP_040923
Red=Cloning sites Green=Tags

MEDINFSSLAPRHGTRPYMGTWNEIGTSQLNGGAFNWNSIWSGLKNFGSTIKTYGTKAWNSQTGQMLRDK
LKDQNFQQKVVDGLASGINGVVDIANQAVQKKIANRLEPRPDEVMVEEKLPPLETVPGSVPTKGEKRPRP
DAEETLVTHTTEPPSYEEAIKQGAALSPTTYPMTKPILPMATRVYGKNENVPMTLELPPLPEPTIADPVG
SVPVASVPVASTVSRPAVRPVAVASLRNPRSSNWQSTLNSIVGLGVKSLKRRRCY

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_001460
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001460.1, NP_040923
RefSeq ORF 795 bp
Locus ID 1460858
MW 28.9 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_001460" in other vectors (35)
SKU Description Size Price
VC100254 Myc-DDK-tagged ORF clone of viral ORF for E1A gene product [Human adenovirus A], codon optimized for human cell expression, NP_040910 10 ug
$330.00
VC100255 Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040911 10 ug
$165.00
VC100256 Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040912 10 ug
$503.00
VC100257 Myc-DDK-tagged ORF clone of viral ORF for IX gene product [Human adenovirus A], codon optimized for human cell expression, NP_040913 10 ug
$165.00
VC100258 Myc-DDK-tagged ORF clone of viral ORF for IVa2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040914 10 ug
$503.00
VC100259 Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040915 10 ug
$589.00 $1,138.00
VC100260 Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040916 10 ug
$165.00
VC100261 Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040917 10 ug
$656.00
VC100262 Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040918 10 ug
$503.00
VC100263 Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040919 10 ug
$596.00
VC100264 Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040920 10 ug
$503.00
VC100265 Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040921 10 ug
$503.00
VC100266 Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040922 10 ug
$165.00
VC100268 Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040924 10 ug
$925.00
VC100269 Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040925 10 ug
$330.00
VC100270 Myc-DDK-tagged ORF clone of viral ORF for E2A-L gene product [Human adenovirus A], codon optimized for human cell expression, NP_040926 10 ug
$503.00
VC100271 Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040927 10 ug
$788.00
VC100272 Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040928 10 ug
$330.00
VC100273 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040929 10 ug
$165.00
VC100274 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040930 10 ug
$165.00
VC100275 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040932 10 ug
$165.00
VC100276 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040931 10 ug
$165.00
VC100277 Myc-DDK-tagged ORF clone of viral ORF for L5 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040933 10 ug
$601.00
VC100278 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040934 10 ug
$330.00
VC100279 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040935 10 ug
$165.00
VC100280 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040936 10 ug
$165.00
VC100281 Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597783 10 ug
$330.00
VC100282 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597784 10 ug
$165.00
VC100283 Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640219 10 ug
$330.00
VC100284 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640220 10 ug
$330.00
VC100285 Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640221 10 ug
$330.00
VC100286 Myc-DDK-tagged ORF clone of viral ORF for U gene product, partial [Human adenovirus A], codon optimized for human cell expression, YP_002640222 10 ug
$165.00
VC100287 Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640218 10 ug
$330.00
VC100288 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640223 10 ug
$165.00
VC100289 Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640224 10 ug
$165.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products