OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AP1AR (NM_001128426) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG225363
AP1AR (tGFP-tagged) - Human adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 2
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA330683 Rabbit Polyclonal Anti-AP1AR Antibody
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "AP1AR or NM_001128426"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AP1AR
Synonyms 2C18; C4orf16; gamma-BAR; GBAR; PRO0971
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG225363 representing NM_001128426
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAACTGCTGCTGGACGCAGTGCTTCGGACTGCTTCGCAAGGAAGCGGGGCGGCTGCAGCGAGTAG
GCGGCGGCGGAGGATCCAAGTATTTTAGAACATGCTCAAGAGGTGAGCACTTAACAATAGAGTTTGAGAA
TCTAGTAGAAAGTGATGAAGGGGAGAGCCCAGGAAGCAGTCATAGGCCTCTTACTGAGGAAGAAATTGTT
GACCTAAGAGAAAGGCATTATGATTCCATTGCCGAAAAACAAAAAGATCTTGATAAGAAAATTCAAAAAG
AGCAAGAAAGGCAGAGAATTGTGCAGCAATATCATCCTTCCAACAATGGAGAATATCAAAGTTCAGGACC
AGAAGATGACTTCGAATCTTGTTTGAGAAATATGAAGTCACAGTATGAAGTTTTTCGAAGTAGTAGACTC
TCATCAGATGCTACAGTTTTGACACCAAATACAGAAAGCAGTTGTGATTTAATGACCAAAACTAAATCAA
CTAGTGGAAATGACGACAGCACATCCTTAGATCTAGAGTGGGAAGATGAAGAAGGAATGAATAGAATGCT
TCCAATGAGAGAACGTTCCAAAACAGAGGAAGACATTCTACGGGCAGCACTTAAGTATAGCAACAAGAAG
ACTGGAAGTAATCCTACATCAGCCTCTGATGATTCCAATGGGCTGGAGTGGGAAAATGATTTTGTTAGTG
CCGAAATGGATGATAATGGAAATTCCGAGTATTCTGGATTTGTAAATCCTGTATTAGAACTGTCTGATTC
TGGCATAAGGCATTCTGACACAGATCAACAGACTCGA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG225363 representing NM_001128426
Red=Cloning site Green=Tags(s)

MGNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIV
DLRERHYDSIAEKQKDLDKKIQKEQERQRIVQQYHPSNNGEYQSSGPEDDFESCLRNMKSQYEVFRSSRL
SSDATVLTPNTESSCDLMTKTKSTSGNDDSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKK
TGSNPTSASDDSNGLEWENDFVSAEMDDNGNSEYSGFVNPVLELSDSGIRHSDTDQQTR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001128426
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001128426.3
RefSeq Size 2812 bp
RefSeq ORF 810 bp
Locus ID 55435
UniProt ID Q63HQ0
Cytogenetics 4q25
Summary Necessary for adaptor protein complex 1 (AP-1)-dependent transport between the trans-Golgi network and endosomes. Regulates the membrane association of AP1G1/gamma1-adaptin, one of the subunits of the AP-1 adaptor complex. The direct interaction with AP1G1/gamma1-adaptin attenuates the release of the AP-1 complex from membranes. Regulates endosomal membrane traffic via association with AP-1 and KIF5B thus linking kinesin-based plus-end-directed microtubular transport to AP-1-dependent membrane traffic. May act as effector of AP-1 in calcium-induced endo-lysosome secretion. Inhibits Arp2/3 complex function; negatively regulates cell spreading, size and motility via intracellular sequestration of the Arp2/3 complex.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001128426" in other vectors (4)
SKU Description Size Price
RC225363 AP1AR (Myc-DDK-tagged)-Human adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 2 10 ug
$300.00
RC225363L3 Lenti ORF clone of Human adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC225363L4 Lenti ORF clone of Human adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 2, mGFP tagged 10 ug
$600.00
SC322936 AP1AR (untagged)-Human adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 2 10 ug
$330.00

Plasmid Map for RG225363

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG225363
Circular map for RG225363

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products