OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AP1AR Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330683
Rabbit Polyclonal Anti-AP1AR Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY413001 Transient overexpression lysate of adaptor-related protein complex 1 associated regulatory protein (AP1AR), transcript variant 1 (as WB positive control) 100 ug
$436.00

View other "AP1AR or NM_018569" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-AP1AR antibody is: synthetic peptide directed towards the C-terminal region of Human AP1AR. Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name adaptor related protein complex 1 associated regulatory protein
Database Link
Background AP1AR is necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. It regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1-adaptin attenuates the release of the AP-1 complex from membranes.
Synonyms 2C18; C4orf16; gamma-BAR; GBAR; PRO0971
Note Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%; Horse: 83%; Rat: 77%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products