OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEA6 (NM_005363) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG223578
MAGEA6 (tGFP-tagged) - Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $650.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA350705 Rabbit Polyclonal Anti-MAGEA6 Antibody
100 ul
$205.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "MAGEA6 or NM_005363"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAGEA6
Synonyms CT1.6; MAGE-3b; MAGE3B; MAGE6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG223578 representing NM_005363
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTTGAGCAGAGGAGTCAGCACTGCAAGCCTGAAGAAGGCCTTGAGGCCCGAGGAGAGGCCCTGG
GCCTGGTGGGTGCGCAGGCTCCTGCTACTGAGGAGCAGGAGGCTGCCTCCTCCTCTTCTACTCTAGTTGA
AGTCACCCTGGGGGAGGTGCCTGCTGCCGAGTCACCAGATCCTCCCCAGAGTCCTCAGGGAGCCTCCAGC
CTCCCCACTACCATGAACTACCCTCTCTGGAGCCAATCCTATGAGGACTCCAGCAACCAAGAAGAGGAGG
GGCCAAGCACCTTCCCTGACCTGGAGTCTGAGTTCCAAGCAGCACTCAGTAGGAAGGTGGCCAAGTTGGT
TCATTTTCTGCTCCTCAAGTATCGAGCCAGGGAGCCGGTCACAAAGGCAGAAATGCTGGGGAGTGTCGTC
GGAAATTGGCAGTACTTCTTTCCTGTGATCTTCAGCAAAGCTTCCGATTCCTTGCAGCTGGTCTTTGGCA
TCGAGCTGATGGAAGTGGACCCCATCGGCCACGTGTACATCTTTGCCACCTGCCTGGGCCTCTCCTACGA
TGGCCTGCTGGGTGACAATCAGATCATGCCCAAGACAGGCTTCCTGATAATCATCCTGGCCATAATCGCA
AAAGAGGGCGACTGTGCCCCTGAGGAGAAAATCTGGGAGGAGCTGAGTGTGTTAGAGGTGTTTGAGGGGA
GGGAAGACAGTATCTTCGGGGATCCCAAGAAGCTGCTCACCCAATATTTCGTGCAGGAAAACTACCTGGA
GTACCGGCAGGTCCCCGGCAGTGATCCTGCATGCTATGAGTTCCTGTGGGGTCCAAGGGCCCTCATTGAA
ACCAGCTATGTGAAAGTCCTGCACCATATGGTAAAGATCAGTGGAGGACCTCGCATTTCCTACCCACTCC
TGCATGAGTGGGCTTTGAGAGAGGGGGAAGAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG223578 representing NM_005363
Red=Cloning site Green=Tags(s)

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLLKYRAREPVTKAEMLGSVV
GNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTGFLIIILAIIA
KEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE
TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005363
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005363.3
RefSeq Size 1723 bp
RefSeq ORF 945 bp
Locus ID 4105
UniProt ID P43360
Cytogenetics Xq28
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005363" in other vectors (6)
SKU Description Size Price
RC223578 MAGEA6 (Myc-DDK-tagged)-Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1 10 ug
$450.00
RC223578L1 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223578L2 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, mGFP tagged 10 ug
$750.00
RC223578L3 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223578L4 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, mGFP tagged 10 ug
$750.00
SC126375 MAGEA6 (untagged)-Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1 10 ug
$300.00

Plasmid Map for RG223578

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG223578
Circular map for RG223578

file-alt Citations

Evaluation of MAGE-A4 expression in breast cancer and its impact on prognosis
Nakamura, Saito, Higashi et al
Cancer Sci (2024)
Cited by 4
AI Summary: OriGene's MAGE-A1 (RG202134), MAGE-A2B (RG215355), MAGE-A3 (RG203288), MAGE-A4 (RG218952), MAGE-A6 (RG223578), MAGE-A9 (RG201760), MAGE-A10 (RG202501), and MAGE-A12 (RG229868) plasmids were used to transfect HEK293 cells, enabling the study to validate the specificity of the novel MAGE-A4 antibody and assess MAGE-A4 expression in breast cancer.
Snippet: …Each plasmid was as follows: MAGE-1 (RG202134), -2B (RG215355), -3 (RG203288), -4 (RG218952), -6 (RG223578), -9 (RG201760), -10 (RG202501), and -12 (RG229868) (OriGene)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products