MAGEA6 (NM_005363) Human Tagged ORF Clone

SKU
RC223578
MAGEA6 (Myc-DDK-tagged)-Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAGEA6
Synonyms CT1.6; MAGE-3b; MAGE3B; MAGE6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223578 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTTGAGCAGAGGAGTCAGCACTGCAAGCCTGAAGAAGGCCTTGAGGCCCGAGGAGAGGCCCTGG
GCCTGGTGGGTGCGCAGGCTCCTGCTACTGAGGAGCAGGAGGCTGCCTCCTCCTCTTCTACTCTAGTTGA
AGTCACCCTGGGGGAGGTGCCTGCTGCCGAGTCACCAGATCCTCCCCAGAGTCCTCAGGGAGCCTCCAGC
CTCCCCACTACCATGAACTACCCTCTCTGGAGCCAATCCTATGAGGACTCCAGCAACCAAGAAGAGGAGG
GGCCAAGCACCTTCCCTGACCTGGAGTCTGAGTTCCAAGCAGCACTCAGTAGGAAGGTGGCCAAGTTGGT
TCATTTTCTGCTCCTCAAGTATCGAGCCAGGGAGCCGGTCACAAAGGCAGAAATGCTGGGGAGTGTCGTC
GGAAATTGGCAGTACTTCTTTCCTGTGATCTTCAGCAAAGCTTCCGATTCCTTGCAGCTGGTCTTTGGCA
TCGAGCTGATGGAAGTGGACCCCATCGGCCACGTGTACATCTTTGCCACCTGCCTGGGCCTCTCCTACGA
TGGCCTGCTGGGTGACAATCAGATCATGCCCAAGACAGGCTTCCTGATAATCATCCTGGCCATAATCGCA
AAAGAGGGCGACTGTGCCCCTGAGGAGAAAATCTGGGAGGAGCTGAGTGTGTTAGAGGTGTTTGAGGGGA
GGGAAGACAGTATCTTCGGGGATCCCAAGAAGCTGCTCACCCAATATTTCGTGCAGGAAAACTACCTGGA
GTACCGGCAGGTCCCCGGCAGTGATCCTGCATGCTATGAGTTCCTGTGGGGTCCAAGGGCCCTCATTGAA
ACCAGCTATGTGAAAGTCCTGCACCATATGGTAAAGATCAGTGGAGGACCTCGCATTTCCTACCCACTCC
TGCATGAGTGGGCTTTGAGAGAGGGGGAAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223578 protein sequence
Red=Cloning site Green=Tags(s)

MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS
LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFLLLKYRAREPVTKAEMLGSVV
GNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTGFLIIILAIIA
KEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIE
TSYVKVLHHMVKISGGPRISYPLLHEWALREGEE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005363
ORF Size 942 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005363.3
RefSeq Size 1723 bp
RefSeq ORF 945 bp
Locus ID 4105
UniProt ID P43360
Cytogenetics Xq28
MW 34.9 kDa
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Write Your Own Review
You're reviewing:MAGEA6 (NM_005363) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223578L1 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223578L2 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, mGFP tagged 10 ug
$750.00
RC223578L3 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC223578L4 Lenti ORF clone of Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1, mGFP tagged 10 ug
$750.00
RG223578 MAGEA6 (tGFP-tagged) - Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1 10 ug
$650.00
SC126375 MAGEA6 (untagged)-Human melanoma antigen family A, 6 (MAGEA6), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.