OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ERAS (NM_181532) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG210965
ERAS (tGFP-tagged) - Human ES cell expressed Ras (ERAS)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA503689 ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "ERAS or NM_181532"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ERAS
Synonyms HRAS2; HRASP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG210965 representing NM_181532
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCCAACAAAGCCTGGCACCTTCGACCTGGGCCTGGCCACATGGAGCCCTTCCTTCCAGGGGG
AAACCCACCGGGCTCAGGCACGCCGCAGGGATGTTGGCAGGCAGCTGCCTGAGTACAAGGCTGTGGTGGT
GGGCGCCAGTGGCGTGGGCAAGAGTGCGCTGACCATCCAGCTGAACCACCAGTGCTTCGTGGAGGACCAC
GACCCCACCATCCAGGATTCCTACTGGAAGGAGTTGACCCTGGACAGTGGGGACTGCATTCTGAATGTGC
TGGACACAGCAGGGCAGGCCATCCATAGGGCCCTGCGTGACCAGTGCCTGGCTGTCTGTGATGGTGTGCT
GGGCGTCTTCGCTCTCGATGACCCCTCGTCTCTGATCCAGCTGCAGCAGATATGGGCCACCTGGGGCCCT
CACCCCGCCCAGCCCCTTGTCCTCGTGGGCAACAAGTGTGACCTTGTGACCACTGCTGGAGATGCTCATG
CCGCTGCTGCAGCCCTCGCACACAGCTGGGGGGCCCACTTCGTGGAGACCTCGGCCAAAACACGGCAAGG
CGTGGAGGAGGCCTTTTCCCTGCTGGTCCATGAGATCCAGAGGGTCCAGGAGGCCATGGCGAAGGAGCCC
ATGGCAAGGTCCTGTAGGGAGAAGACCCGGCACCAGAAGGCCACCTGCCACTGTGGCTGCTCTGTGGCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210965 representing NM_181532
Red=Cloning site Green=Tags(s)

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP
MARSCREKTRHQKATCHCGCSVA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_181532
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181532.3
RefSeq Size 1266 bp
RefSeq ORF 702 bp
Locus ID 3266
UniProt ID Q7Z444
Cytogenetics Xp11.23
Protein Families Druggable Genome
Summary This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. provided by RefSeq, Dec 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_181532" in other vectors (6)
SKU Description Size Price
RC210965 ERAS (Myc-DDK-tagged)-Human ES cell expressed Ras (ERAS) 10 ug
$300.00
RC210965L1 Lenti ORF clone of Human ES cell expressed Ras (ERAS), Myc-DDK-tagged 10 ug
$600.00
RC210965L2 Lenti ORF clone of Human ES cell expressed Ras (ERAS), mGFP tagged 10 ug
$600.00
RC210965L3 Lenti ORF clone of Human ES cell expressed Ras (ERAS), Myc-DDK-tagged 10 ug
$600.00
RC210965L4 Lenti ORF clone of Human ES cell expressed Ras (ERAS), mGFP tagged 10 ug
$600.00
SC307300 ERAS (untagged)-Human ES cell expressed Ras (ERAS) 10 ug
$300.00

Plasmid Map for RG210965

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG210965
Circular map for RG210965

file-alt Citations

The function of embryonic stem cell-expressed Ras (E-Ras), a unique Ras family member, correlates with its additional motifs and its structural properties
Nakhaei-Rad, Nakhaeizadeh, Kordes et al
J. Biol. Chem. (2015)
AI Summary: OriGene’s pCMV6-AC-hsE-RAS plasmid was used to obtain human E-Ras cDNA, enabling the study of E-Ras’s unique sequence and structural features in this research.
Snippet: nucleotide dissociation stimulator (RalGDS) and phospholipase C epsilon (PLCɛ). MATERIALS AND METHODS Constructs—Human E-Ras cDNA was obtained from pCMV6-AC-hsE-RAS (Origene). Human H-Ras was obtained from ptacH-RAS (43). ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products