ERAS (NM_181532) Human Tagged ORF Clone

SKU
RC210965
ERAS (Myc-DDK-tagged)-Human ES cell expressed Ras (ERAS)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ERAS
Synonyms HRAS2; HRASP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210965 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCCAACAAAGCCTGGCACCTTCGACCTGGGCCTGGCCACATGGAGCCCTTCCTTCCAGGGGG
AAACCCACCGGGCTCAGGCACGCCGCAGGGATGTTGGCAGGCAGCTGCCTGAGTACAAGGCTGTGGTGGT
GGGCGCCAGTGGCGTGGGCAAGAGTGCGCTGACCATCCAGCTGAACCACCAGTGCTTCGTGGAGGACCAC
GACCCCACCATCCAGGATTCCTACTGGAAGGAGTTGACCCTGGACAGTGGGGACTGCATTCTGAATGTGC
TGGACACAGCAGGGCAGGCCATCCATAGGGCCCTGCGTGACCAGTGCCTGGCTGTCTGTGATGGTGTGCT
GGGCGTCTTCGCTCTCGATGACCCCTCGTCTCTGATCCAGCTGCAGCAGATATGGGCCACCTGGGGCCCT
CACCCCGCCCAGCCCCTTGTCCTCGTGGGCAACAAGTGTGACCTTGTGACCACTGCTGGAGATGCTCATG
CCGCTGCTGCAGCCCTCGCACACAGCTGGGGGGCCCACTTCGTGGAGACCTCGGCCAAAACACGGCAAGG
CGTGGAGGAGGCCTTTTCCCTGCTGGTCCATGAGATCCAGAGGGTCCAGGAGGCCATGGCGAAGGAGCCC
ATGGCAAGGTCCTGTAGGGAGAAGACCCGGCACCAGAAGGCCACCTGCCACTGTGGCTGCTCTGTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210965 protein sequence
Red=Cloning site Green=Tags(s)

MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDH
DPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGP
HPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEP
MARSCREKTRHQKATCHCGCSVA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181532
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181532.3
RefSeq Size 826 bp
RefSeq ORF 702 bp
Locus ID 3266
UniProt ID Q7Z444
Cytogenetics Xp11.23
Protein Families Druggable Genome
MW 25.3 kDa
Summary This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:ERAS (NM_181532) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210965L1 Lenti ORF clone of Human ES cell expressed Ras (ERAS), Myc-DDK-tagged 10 ug
$600.00
RC210965L2 Lenti ORF clone of Human ES cell expressed Ras (ERAS), mGFP tagged 10 ug
$600.00
RC210965L3 Lenti ORF clone of Human ES cell expressed Ras (ERAS), Myc-DDK-tagged 10 ug
$600.00
RC210965L4 Lenti ORF clone of Human ES cell expressed Ras (ERAS), mGFP tagged 10 ug
$600.00
RG210965 ERAS (tGFP-tagged) - Human ES cell expressed Ras (ERAS) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC307300 ERAS (untagged)-Human ES cell expressed Ras (ERAS) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.