OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Serum Response Factor (SRF) (NM_003131) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG208596
SRF (tGFP-tagged) - Human serum response factor (c-fos serum response element-binding transcription factor) (SRF)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $673.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA381996 SRF Rabbit polyclonal Antibody
100 ul
$410.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Serum Response Factor or NM_003131"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Serum Response Factor
Synonyms MCM1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208596 representing NM_003131
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCGACCCAAGCTGGGGCCGCGGCGGCTCTGGGCCGGGGCTCGGCCCTGGGGGGCAGCCTGAACC
GGACCCCGACGGGGCGGCCGGGCGGCGGCGGCGGGACACGCGGGGCTAACGGGGGCCGGGTCCCCGGGAA
TGGCGCGGGGCTCGGGCCCGGCCGCCTGGAGCGGGAGGCTGCGGCAGCGGCGGCAACCACCCCGGCGCCC
ACCGCGGGGGCCCTCTACAGCGGCAGCGAGGGCGACTCGGAGTCGGGCGAGGAGGAGGAGCTGGGCGCCG
AGCGGCGCGGCCTGAAGCGGAGCCTGAGCGAGATGGAGATCGGTATGGTGGTCGGTGGGCCCGAGGCGTC
GGCAGCGGCCACCGGGGGCTACGGGCCGGTGAGCGGCGCGGTGAGCGGGGCCAAGCCGGGTAAGAAGACC
CGGGGCCGCGTGAAGATCAAGATGGAGTTCATCGACAACAAGCTGCGGCGCTACACGACCTTCAGCAAGA
GGAAGACGGGCATCATGAAGAAGGCCTATGAGCTGTCCACGCTGACAGGGACACAGGTGCTGTTGCTGGT
GGCCAGTGAGACAGGCCATGTGTATACCTTTGCCACCCGAAAACTGCAGCCCATGATCACCAGTGAGACC
GGCAAGGCACTGATTCAGACCTGCCTCAACTCGCCAGACTCTCCACCCCGTTCAGACCCCACAACAGACC
AGAGAATGAGTGCCACTGGCTTTGAAGAGACAGATCTCACCTACCAGGTGTCGGAGTCTGACAGCAGTGG
GGAGACCAAGGACACACTGAAGCCGGCGTTCACAGTCACCAACCTGCCGGGTACAACCTCCACCATCCAA
ACAGCACCTAGCACCTCTACCACCATGCAAGTCAGCAGCGGCCCCTCCTTTCCCATCACCAACTACCTGG
CACCAGTGTCTGCTAGTGTCAGCCCCAGTGCTGTCAGCAGTGCCAATGGGACTGTGCTGAAGAGTACAGG
CAGCGGCCCTGTCTCCTCTGGGGGCCTTATGCAGCTGCCTACCAGCTTCACCCTCATGCCTGGTGGGGCA
GTGGCCCAGCAGGTCCCAGTGCAGGCCATTCAAGTGCACCAGGCCCCACAGCAAGCGTCTCCCTCCCGTG
ACAGCAGCACAGACCTCACGCAGACCTCCTCCAGCGGGACAGTGACGCTGCCCGCCACCATCATGACGTC
ATCCGTGCCCACAACTGTGGGTGGCCACATGATGTACCCTAGCCCGCATGCGGTGATGTATGCCCCCACC
TCGGGCCTGGGTGATGGCAGCCTCACCGTGCTGAATGCCTTCTCCCAGGCACCATCCACCATGCAGGTGT
CACACAGCCAGGTCCAGGAGCCAGGTGGCGTCCCCCAGGTGTTCCTGACAGCATCATCTGGGACAGTGCA
GATCCCTGTTTCAGCAGTTCAGCTCCACCAGATGGCTGTGATAGGGCAGCAGGCCGGGAGCAGCAGCAAC
CTCACCGAGCTACAGGTGGTGAACCTGGACACCGCCCACAGCACCAAGAGTGAA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208596 representing NM_003131
Red=Cloning site Green=Tags(s)

MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAP
TAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKT
RGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSET
GKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQ
TAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGA
VAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSN
LTELQVVNLDTAHSTKSE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003131
ORF Size 1524 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003131.4
RefSeq Size 4343 bp
RefSeq ORF 1527 bp
Locus ID 6722
UniProt ID P11831
Cytogenetics 6p21.1
Domains MADS
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway
Summary This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003131" in other vectors (6)
SKU Description Size Price
RC208596 SRF (Myc-DDK-tagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF) 10 ug
$473.00
RC208596L1 Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), Myc-DDK-tagged 10 ug
$773.00
RC208596L2 Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged 10 ug
$773.00
RC208596L3 Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), Myc-DDK-tagged 10 ug
$773.00
RC208596L4 Lenti ORF clone of Human serum response factor (c-fos serum response element-binding transcription factor) (SRF), mGFP tagged 10 ug
$773.00
SC118177 SRF (untagged)-Human serum response factor (c-fos serum response element-binding transcription factor) (SRF) 10 ug
$474.00

Plasmid Map for RG208596

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG208596
Circular map for RG208596

file-alt Citations

Serum Response Factor (SRF) Drives the Transcriptional Upregulation of the MDM4 Oncogene in HCC
Pellegrino, Thavamani, Calvisi et al
Cancers (Basel) (2021) 13 (2) DOI: 10.3390/cancers13020199
Cited by 13
AI Summary: OriGene’s pCMV6-AC-GFP vector containing full-length human SRF cDNA (catalog #RG208596) was used for transient transfection experiments to investigate the role of SRF in MDM4 transcriptional regulation in hepatocellular carcinoma.
Snippet: tion. STR profiling was performed for authentication of HCC cell lines. HLE cells were transiently transfected with a pCMV6-AC-GFP vector containing either a full-length human SRF cDNA (RG208596 from OriGene Technologies, Rockville, MD, USA), or a pCGN vector containing a full-length human ELK1 cDNA, an inactive ELK1 variant (ELK1 S383A cDNA), or a pCS2plus vector containing a SRF-VP16 cDNA [26] f
FigureFigureFigure
Nuclear PTEN functions as an essential regulator of SRF-dependent transcription to control smooth muscle differentiation
Horita, Wysoczynski, Walker et al
Nat Commun (2016) 7, 10830 DOI: 10.1038/ncomms10830
Cited by 75
AI Summary: In this study, OriGene’s plasmid-encoding human SRF tagged with GFP (catalog #RG208596) was used to investigate the interaction between PTEN and SRF in regulating smooth muscle cell differentiation.
Snippet: For recombinant protein expression, SRF–GST plasmid was generated in pGEX-5X-3 (Amersham) and PTEN-His vector was a gift from Dr Yamada57. …Plasmid-encoding human SRF tagged with GFP (RG208596) was obtained from OriGene. SMCs co-transfected with SRF–GFP and PTEN localization mutants were performed with Viafect transfection reagent (E4982) (Promega, WI). …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products