OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OLIG2 (NM_005806) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG208209
OLIG2 (tGFP-tagged) - Human oligodendrocyte lineage transcription factor 2 (OLIG2)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA349037 Rabbit Polyclonal Anti-OLIG2 Antibody
100 ug
$640.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "OLIG2 or NM_005806"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OLIG2
Synonyms BHLHB1; bHLHe19; OLIGO2; PRKCBP2; RACK17
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208209 representing NM_005806
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACTCGGACGCCAGCCTGGTGTCCAGCCGCCCGTCGTCGCCAGAGCCCGATGACCTTTTTCTGCCGG
CCCGGAGTAAGGGCAGCAGCGGCAGCGCCTTCACTGGGGGCACCGTGTCCTCGTCCACCCCGAGTGACTG
CCCGCCGGAGCTGAGCGCCGAGCTGCGCGGCGCTATGGGCTCTGCGGGCGCGCATCCTGGGGACAAGCTA
GGAGGCAGTGGCTTCAAGTCATCCTCGTCCAGCACCTCGTCGTCTACGTCGTCGGCGGCTGCGTCGTCCA
CCAAGAAGGACAAGAAGCAAATGACAGAGCCGGAGCTGCAGCAGCTGCGTCTCAAGATCAACAGCCGCGA
GCGCAAGCGCATGCACGACCTCAACATCGCCATGGATGGCCTCCGCGAGGTCATGCCGTACGCACACGGC
CCTTCGGTGCGCAAGCTTTCCAAGATCACCACGCTGCTGCTGGCGCGCAACTACATCCTCATGCTCACCA
ACTCGCTGGAGGAGATGAAGCGACTGGTGAGCGAGATCTACGGGGGCCACCACGCTGGCTTCCACCCGTC
GGCCTGCGGCGGCCTGGCGCACTCCGCGCCCCTGCCCGCCGCCACCGCGCACCCGGCAGCAGCAGCGCAC
GCCGCACATCACCCCGCGGTGCACCACCCCATCCTGCCGCCCGCCGCCGCAGCGGCTGCTGCCGCCGCTG
CAGCCGCGGCTGTGTCCAGCGCCTCTCTGCCCGGATCCGGGCTGCCGTCGGTCGGCTCAATCCGTCCACC
GCACGGCCTACTCAAGTCTCCGTCTGCTGCCGCGGCCGCCCCGCTGGGGGGCGGGGGCGGCGGCAGTGGG
GCGAGCGGGGGCTTCCAGCACTGGGGCGGCATGCCCTGCCCCTGCAGCATGTGCCAGGTGCCGCCGCCGC
ACCACCACGTGTCGGCTATGGGCGCCGGCAGCCTGCCGCGCCTCACCTCCGACGCCAAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208209 representing NM_005806
Red=Cloning site Green=Tags(s)

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL
GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG
PSVRKLSKITTLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH
AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG
ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005806
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005806.2, NP_005797.1
RefSeq Size 2505 bp
RefSeq ORF 972 bp
Locus ID 10215
UniProt ID Q13516
Cytogenetics 21q22.11
Domains HLH
Protein Families Druggable Genome, Transcription Factors
Summary This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005806" in other vectors (7)
SKU Description Size Price
RC208209 OLIG2 (Myc-DDK-tagged)-Human oligodendrocyte lineage transcription factor 2 (OLIG2) 10 ug
$300.00
RC208209L1 Lenti ORF clone of Human oligodendrocyte lineage transcription factor 2 (OLIG2), Myc-DDK-tagged 10 ug
$600.00
RC208209L2 Lenti ORF clone of Human oligodendrocyte lineage transcription factor 2 (OLIG2), mGFP tagged 10 ug
$600.00
RC208209L3 Lenti ORF clone of Human oligodendrocyte lineage transcription factor 2 (OLIG2), Myc-DDK-tagged 10 ug
$600.00
RC208209L4 Lenti ORF clone of Human oligodendrocyte lineage transcription factor 2 (OLIG2), mGFP tagged 10 ug
$600.00
SC103224 OLIG2 (untagged)-Human oligodendrocyte lineage transcription factor 2 (OLIG2) 10 ug
$300.00
SC322126 OLIG2 (untagged)-Human oligodendrocyte lineage transcription factor 2 (OLIG2) 10 ug
$300.00

Plasmid Map for RG208209

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG208209
Circular map for RG208209

file-alt Citations

Enhancing Oligodendrocyte Differentiation by Transient Transcription Activation via DNA Nanoparticle-Mediated Transfection
Li, Tzeng, Zamboni et al
Acta Biomater (2017)
AI Summary: OriGene products, specifically the human Olig2 (RG208209) and Olig1 (SC123482) expression plasmids, were used in this study to deliver key transcription factors that promoted efficient oligodendrocyte differentiation via nanoparticle-mediated transfection.
Snippet: Homo sapiens oligodendrocyte transcription factor 2 (Ol ig2, RG208209) and oligodendrocyte transcription factor 1 (Olig1, SC123482) were purchased from Origene Technologies (Rockville, MD)
Nanoparticle-mediated conversion of primary human astrocytes into neurons and oligodendrocytes
Li, Kozielski, Cheng et al
Biomater Sci (2016) 4 (7), 1100-12 DOI: 10.1039/c6bm00140h
Cited by 27
AI Summary: OriGene products contributed to this study by providing the Sox2 (RC213652) and Olig2 (RC211274) expression plasmids, which were delivered into primary human astrocytes using nanoparticles to induce their conversion into neurons and oligodendrocyte progenitors.
FigureFigure
Nanoparticle-mediated conversion of primary human astrocytes into neurons and oligodendrocytes
Li, Kozielski, Cheng et al
Biomater. Sci. (2016)
Snippet: Materials. Homo sapiens SRY (sex determining region Y)-box 2 (Sox2, CMV Promoter, RG200757) and oligodendrocyte transcription factor 2 (Olig2, CMV Promoter, RG208209) as transfection-ready DNAs were obtained from OriGene Technologies (Rockville, ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products