OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GFAP (NM_002055) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG204548
GFAP (tGFP-tagged) - Human glial fibrillary acidic protein (GFAP), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $657.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA500338 Anti-GFAP mouse monoclonal antibody, clone OTI4D11 (formerly 4D11) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "GFAP or NM_002055"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GFAP
Synonyms ALXDRD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204548 representing NM_002055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGGAGACGCATCACCTCCGCTGCTCGCCGCTCCTACGTCTCCTCAGGGGAGATGATGGTGGGGG
GCCTGGCTCCTGGCCGCCGTCTGGGTCCTGGCACCCGCCTCTCCCTGGCTCGAATGCCCCCTCCACTCCC
GACCCGGGTGGATTTCTCCCTGGCTGGGGCACTCAATGCTGGCTTCAAGGAGACCCGGGCCAGTGAGCGG
GCAGAGATGATGGAGCTCAATGACCGCTTTGCCAGCTACATCGAGAAGGTTCGCTTCCTGGAACAGCAAA
ACAAGGCGCTGGCTGCTGAGCTGAACCAGCTGCGGGCCAAGGAGCCCACCAAGCTGGCAGACGTCTACCA
GGCTGAGCTGCGAGAGCTGCGGCTGCGGCTCGATCAACTCACCGCCAACAGCGCCCGGCTGGAGGTTGAG
AGGGACAATCTGGCACAGGACCTGGCCACTGTGAGGCAGAAGCTCCAGGATGAAACCAACCTGAGGCTGG
AAGCCGAGAACAACCTGGCTGCCTATAGACAGGAAGCAGATGAAGCCACCCTGGCCCGTCTGGATCTGGA
GAGGAAGATTGAGTCGCTGGAGGAGGAGATCCGGTTCTTGAGGAAGATCCACGAGGAGGAGGTTCGGGAA
CTCCAGGAGCAGCTGGCCCGACAGCAGGTCCATGTGGAGCTTGACGTGGCCAAGCCAGACCTCACCGCAG
CCCTGAAAGAGATCCGCACGCAGTATGAGGCAATGGCGTCCAGCAACATGCATGAAGCCGAAGAGTGGTA
CCGCTCCAAGTTTGCAGACCTGACAGACGCTGCTGCCCGCAACGCGGAGCTGCTCCGCCAGGCCAAGCAC
GAAGCCAACGACTACCGGCGCCAGTTGCAGTCCTTGACCTGCGACCTGGAGTCTCTGCGCGGCACGAACG
AGTCCCTGGAGAGGCAGATGCGCGAGCAGGAGGAGCGGCACGTGCGGGAGGCGGCCAGTTATCAGGAGGC
GCTGGCGCGGCTGGAGGAAGAGGGGCAGAGCCTCAAGGACGAGATGGCCCGCCACTTGCAGGAGTACCAG
GACCTGCTCAATGTCAAGCTGGCCCTGGACATCGAGATCGCCACCTACAGGAAGCTGCTAGAGGGCGAGG
AGAACCGGATCACCATTCCCGTGCAGACCTTCTCCAACCTGCAGATTCGAGAAACCAGCCTGGACACCAA
GTCTGTGTCAGAAGGCCACCTCAAGAGGAACATCGTGGTGAAGACCGTGGAGATGCGGGATGGAGAGGTC
ATTAAGGAGTCCAAGCAGGAGCACAAGGATGTGATG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204548 representing NM_002055
Red=Cloning site Green=Tags(s)

MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER
AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE
RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE
LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH
EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ
DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV
IKESKQEHKDVM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002055
ORF Size 1296 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002055.5
RefSeq Size 3035 bp
RefSeq ORF 1299 bp
Locus ID 2670
UniProt ID P14136, A7REI1
Cytogenetics 17q21.31
Domains filament, filament_head
Protein Families ES Cell Differentiation/IPS
Summary This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002055" in other vectors (6)
SKU Description Size Price
RC204548 GFAP (Myc-DDK-tagged)-Human glial fibrillary acidic protein (GFAP), transcript variant 1 10 ug
$457.00
RC204548L1 Lenti ORF clone of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204548L2 Lenti ORF clone of Human glial fibrillary acidic protein (GFAP), transcript variant 1, mGFP tagged 10 ug
$757.00
RC204548L3 Lenti ORF clone of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204548L4 Lenti ORF clone of Human glial fibrillary acidic protein (GFAP), transcript variant 1, mGFP tagged 10 ug
$757.00
SC118873 GFAP (untagged)-Human glial fibrillary acidic protein (GFAP), transcript variant 1 10 ug
$457.00

Plasmid Map for RG204548

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG204548
Circular map for RG204548

file-alt Citations

Involvement of TNFRSF9 in the Pathogenesis of Autoimmune Glial Fibrillary Acidic Protein Astrocytopathy
Kimura, Takekoshi, Maekawa et al
Neurology (2026) 107 (3), e218306 DOI: 10.1212/WNL.0000000000218306
AI Summary: OriGene’s pCMV6-AC-GFAP-α-GFP plasmid (catalog #RG204548) was used to transfect HEK293 cells for cell-based assays to detect GFAP-IgG in patient CSF, supporting the study’s biomarker analyses.
Snippet: CBA was further conducted using HEK293 cells transfected with a plasmid (RG204548;pCMV6-AC-GFAP-α-GFP) obtained from OriGene (Rockville, MD), encoding the Homo sapiens GFAP transcript variant 1. Fixed cells were incubated with diluted CSF (1:4) for 1 hour at room temperature
Investigation of Prognostic Factors in Patients With Autoimmune Glial Fibrillary Acidic Protein Astrocytopathy
Kimura, Takekoshi, Maekawa et al
Eur J Neurol (2026) 33 (1), e70489 DOI: 10.1111/ene.70489
Cited by 5
AI Summary: OriGene's GFAPα-GFP plasmid (RG204548) was used to transfect HEK293 cells for cell-based assays to detect GFAP-IgG in patient cerebrospinal fluid, contributing to the diagnosis and analysis of autoimmune GFAP astrocytopathy in this study.
Snippet: For CBA, HEK293 cells transfected with a GFAPα-GFP plasmid (OriGene, RG204548) were fixed and incubated with diluted CSF (1:4) for 1 h at room temperature. …For CBA, HEK293 cells transfected with a GFAPα‐GFP plasmid (OriGene, RG204548) were fixed and incubated with diluted CSF (1:4) for 1 h at room temperature. …
FigureFigureFigure
Intrathecal Epstein-Barr virus reactivation in patients with autoimmune glial fibrillary acidic protein astrocytopathy
Handa, Uzawa, Kimura et al
J Neurol Neurosurg Psychiatry (2025)
Cited by 4
AI Summary: OriGene's GFAPα-GFP plasmid (pCMV6-AC-GFAPα-GFP; catalogue no: RG204548) was used to transfect HEK293 cells for cell-based assays to detect GFAPα autoantibodies in cerebrospinal fluid samples, contributing to the investigation of autoimmunity in patients with GFAP astrocytopathy.
Snippet: GFAPα autoantibodies were determined in Gifu University. Briefly, CSF samples were diluted fourfold and the CSF-GFAPα autoantibodies were assayed using CBA in HEK293 cells transfected with a GFAPα-GFP plasmid (pCMV6-AC-GFAPα-GFP;catalogue no: RG204548;Origene, Rockville, Maryland, USA), following the protocol by Flanagan et al.2 16 Additionally, immunohistochemistry was performed to confirm immunoreactivity to GFAP in frozen rat brain sections (catalogue no:
Clinical and neuroimaging findings of patients with glial fibrillary acidic protein-immunoglobulin G-like anti-astrocytic antibodies in cerebrospinal fluid
Kimura, Takekoshi, Shimohata
J Neuroimmunol (2025) 400, 578545 DOI: 10.1016/j.jneuroim.2025.578545
AI Summary: OriGene’s pCMV6-AC-GFAP-α-GFP plasmid (RG204548) was used to transfect HEK293 cells for the cell-based assay to assess patient antibodies’ reactivity against GFAPα in this study.
Snippet: ples according to previous reports (Flanagan et al., 2017;Kimura et al., 2019). The CBA employed human embryonic kidney 293 (HEK293) cells transfected with a plasmid from OriGene (Rockville, MD, USA) encoding the single Homo sapiens GFAP transcript variant 1 (RG204548;pCMV6-AC-GFAP-α-GFP). Transfected cells were fixed with 2 % paraformaldehyde for 20 min an
Serum glial fibrillary acidic protein (GFAP)-antibody in idiopathic intracranial hypertension
Yetimler, Tzartos, Şengül et al
Int. J. Neurosci. (2020)
Cited by 19
AI Summary: OriGene's pCMV6-AC-GFAP-α-GFP plasmid was used to transfect HEK293 cells for the cell-based assay that enabled detection of GFAP antibodies in patient sera and CSF samples in this study.
Snippet: Sera and CSF of all patients and controls were examined for GFAP-antibody by a cell-based assay (CBA) using HEK293 cells transfected with the pCMV6-AC-GFAP-α-GFP plasmid (OriGene, Rockville, MD, USA), as previously described [13,14];- Sera and CSF of all patients and controls were examined for GFAP-antibody by a cell-based assay (CBA) using HEK293 cells transfected with the pCMV6-AC-GFAP-α-GFP plasmid (OriGene, Rockville, MD, USA), as previously described [13,14]
IHC
Glial fibrillary acidic protein (GFAP)-antibody in children with focal seizures of undetermined cause
Savaş, Tzartos, Küçükali et al
Acta Neurol Belg (2020)
Cited by 19
AI Summary: OriGene's pCMV6-AC-GFAP-α-GFP plasmid was used to transfect HEK293 cells for the cell-based assay that enabled detection of GFAP antibodies in children with focal seizures of undetermined cause.
Snippet: … GFAP-antibody detection was achieved by a cell-based assay (CBA) using HEK293 cells transfected with the pCMV6-AC-GFAP-α-GFP plasmid (OriGene, Rockville, MD, USA), as previously described [9, 15]. … GFAP-antibody detection was achieved by a cell-based assay (CBA) using HEK293 cells transfected with the pCMV6-AC-GFAP-α-GFP plasmid (OriGene, Rockville, MD, USA), as previously described [9, 15]. …
Showing 1-6 of 12 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products