OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COPE (NM_007263) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG203531
COPE (tGFP-tagged) - Human coatomer protein complex, subunit epsilon (COPE), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA324398 COPE Antibody (C-term)
400 ul
$645.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "COPE or NM_007263"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COPE
Synonyms epsilon-COP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG203531 representing NM_007263
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCTCCGGCCCCCGGCCCGGCCTCCGGCGGCTCCGGGGAGGTAGACGAGCTGTTCGACGTAAAGA
ACGCCTTCTACATCGGCAGCTACCAGCAGTGCATAAACGAGGCGCAGCGGGTGAAGCTGTCAAGCCCAGA
GAGAGACGTGGAGAGGGACGTCTTCCTGTATAGAGCGTACCTGGCGCAGAGGAAGTTCGGTGTGGTCCTG
GATGAGATCAAGCCCTCCTCGGCCCCTGAGCTCCAGGCCGTGCGCATGTTTGCTGACTACCTCGCCCACG
AGAGTCGGAGGGACAGCATCGTGGCCGAGCTGGACCGAGAGATGAGCAGGAGCGTGGACGTGACCAACAC
CACCTTCCTGCTCATGGCCGCCTCCATCTATCTCCACGACCAGAACCCGGATGCCGCCCTGCGTGCGCTG
CACCAGGGGGACAGCCTGGAGTGCACAGCCATGACAGTGCAGATCCTGCTGAAGCTGGACCGCCTGGACC
TCGCCCGGAAGGAGCTGAAGAGAATGCAGGACCTGGACGAGGATGCCACCCTCACCCAGCTCGCCACTGC
CTGGGTCAGCCTGGCCACGGGTGGTGAGAAGCTGCAGGATGCCTACTACATCTTCCAGGAGATGGCTGAC
AAGTGCTCGCCCACCCTGCTGCTGCTCAATGGGCAGGCGGCCTGCCACATGGCCCAGGGCCGCTGGGAGG
CCGCTGAGGGCCTGCTGCAGGAGGCGCTAGACAAGGATAGTGGCTACCCGGAGACGCTGGTCAACCTCAT
CGTCCTGTCCCAGCACCTGGGCAAGCCCCCTGAGGTGACAAACCGATACCTGTCCCAGCTGAAGGATGCC
CACAGGTCCCATCCCTTCATCAAGGAGTACCAGGCCAAGGAGAACGACTTTGACAGGCTGGTGCTACAGT
ACGCTCCCAGCGCC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203531 representing NM_007263
Red=Cloning site Green=Tags(s)

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYLAQRKFGVVL
DEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFLLMAASIYLHDQNPDAALRAL
HQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAWVSLATGGEKLQDAYYIFQEMAD
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA
HRSHPFIKEYQAKENDFDRLVLQYAPSA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_007263
ORF Size 924 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007263.2
RefSeq Size 1134 bp
RefSeq ORF 927 bp
Locus ID 11316
UniProt ID O14579
Cytogenetics 19p13.11
Domains Coatomer_E
Summary The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_007263" in other vectors (4)
SKU Description Size Price
RC203531 COPE (Myc-DDK-tagged)-Human coatomer protein complex, subunit epsilon (COPE), transcript variant 1 10 ug
$300.00
RC203531L3 Lenti ORF clone of Human coatomer protein complex, subunit epsilon (COPE), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203531L4 Lenti ORF clone of Human coatomer protein complex, subunit epsilon (COPE), transcript variant 1, mGFP tagged 10 ug
$600.00
SC319189 COPE (untagged)-Human coatomer protein complex, subunit epsilon (COPE), transcript variant 1 10 ug
$300.00

Plasmid Map for RG203531

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG203531
Circular map for RG203531

file-alt Citations

Dissecting the role of COPI complexes in influenza virus infection
Sun, He, Zhuang
J. Virol. (2013) 87 (5), 2673-85 DOI: 10.1128/JVI.02277-12
AI Summary: OriGene's COPE-GFP plasmid was used in this study to express and visualize the COPI complex subunit COPE in A549 cells, enabling the authors to investigate the role of COPI in influenza virus infection.
Snippet: For plasmid expression, A549 cells were electroporated with 2 μg of either COPE-green fluorescent protein (GFP) (OriGene) or Rab7-GFP (a generous gift from Qing Zhong) (34) plasmid using kit T and Nucleofector program X-001.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products