OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RASD2 (NM_014310) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201454
RASD2 (tGFP-tagged) - Human RASD family, member 2 (RASD2)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA501978 RASD2 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "RASD2 or NM_014310"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RASD2
Synonyms Rhes; TEM2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201454 representing NM_014310
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAAGACTTTGTCCAGCGGGAACTGCACGCTCAGTGTGCCCGCCAAAAACTCATACCGCATGGTGG
TGCTGGGTGCCTCTCGGGTGGGCAAGAGCTCCATCGTGTCTCGCTTCCTCAATGGCCGCTTTGAGGACCA
GTACACACCCACCATCGAGGACTTCCACCGTAAGGTATACAACATCCGCGGCGACATGTACCAGCTCGAC
ATCCTGGATACCTCTGGCAACCACCCCTTCCCCGCCATGCGCAGGCTGTCCATCCTCACAGGGGATGTCT
TCATCCTGGTGTTCAGCCTGGATAACCGGGAGTCCTTCGATGAGGTCAAGCGCCTTCAGAAGCAGATCCT
GGAGGTCAAGTCCTGCCTGAAGAACAAGACCAAGGAGGCGGCGGAGCTGCCCATGGTCATCTGTGGCAAC
AAGAACGACCACGGCGAGCTGTGCCGCCAGGTGCCCACCACCGAGGCCGAGCTGCTGGTGTCGGGCGACG
AGAACTGCGCCTACTTCGAGGTGTCGGCCAAGAAGAACACCAACGTGGACGAGATGTTCTACGTGCTCTT
CAGCATGGCCAAGCTGCCACACGAGATGAGCCCCGCCCTGCATCGCAAGATCTCCGTGCAGTACGGTGAC
GCCTTCCACCCCAGGCCCTTCTGCATGCGCCGCGTCAAGGAGATGGACGCCTATGGCATGGTCTCGCCCT
TCGCCCGCCGCCCCAGCGTCAACAGTGACCTCAAGTACATCAAGGCCAAGGTCCTTCGGGAAGGCCAGGC
CCGTGAGAGGGACAAGTGCACCATCCAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201454 representing NM_014310
Red=Cloning site Green=Tags(s)

MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLD
ILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGN
KNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGD
AFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014310
ORF Size 798 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014310.4
RefSeq Size 3047 bp
RefSeq ORF 801 bp
Locus ID 23551
UniProt ID Q96D21
Cytogenetics 22q12.3
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Summary This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014310" in other vectors (7)
SKU Description Size Price
RC201454 RASD2 (Myc-DDK-tagged)-Human RASD family, member 2 (RASD2) 10 ug
$300.00
RC201454L1 Lenti ORF clone of Human RASD family, member 2 (RASD2), Myc-DDK-tagged 10 ug
$600.00
RC201454L2 Lenti ORF clone of Human RASD family, member 2 (RASD2), mGFP tagged 10 ug
$600.00
RC201454L3 Lenti ORF clone of Human RASD family, member 2 (RASD2), Myc-DDK-tagged 10 ug
$600.00
RC201454L4 Lenti ORF clone of Human RASD family, member 2 (RASD2), mGFP tagged 10 ug
$600.00
SC115073 RASD2 (untagged)-Human RASD family, member 2 (RASD2) 10 ug
$300.00
SC324438 RASD2 (untagged)-Human RASD family, member 2 (RASD2) 10 ug
$300.00

Plasmid Map for RG201454

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201454
Circular map for RG201454

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products