OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAL (NM_002371) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201256
MAL (tGFP-tagged) - Human mal, T-cell differentiation protein (MAL), transcript variant a
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $489.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "MAL or NM_002371"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAL
Synonyms MVP17; VIP17
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201256 representing NM_002371
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCGCAGCGGCGACGGGGGGCAGCACCCTGCCCAGTGGCTTCTCGGTCTTCACCACCTTGCCCG
ACTTGCTCTTCATCTTTGAGTTTATCTTCGGGGGCCTGGTGTGGATCCTGGTGGCCTCCTCCCTGGTGCC
CTGGCCCCTGGTCCAGGGCTGGGTGATGTTCGTGTCTGTGTTCTGCTTCGTGGCCACCACCACCTTGATC
ATCCTGTACATAATTGGAGCCCACGGTGGAGAGACTTCCTGGGTCACCTTGGACGCAGCCTACCACTGCA
CCGCTGCCCTCTTTTACCTCAGCGCCTCAGTCCTGGAGGCCCTGGCCACCATCACGATGCAAGACGGCTT
CACCTACAGGCACTACCATGAAAACATTGCTGCCGTGGTGTTCTCCTACATAGCCACTCTGCTCTACGTG
GTCCATGCGGTGTTCTCTTTAATCAGATGGAAGTCTTCA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201256 representing NM_002371
Red=Cloning site Green=Tags(s)

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI
ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV
VHAVFSLIRWKSS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_002371
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002371.4
RefSeq Size 1056 bp
RefSeq ORF 462 bp
Locus ID 4118
UniProt ID P21145
Cytogenetics 2q11.1
Protein Families Transmembrane
Summary The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. provided by RefSeq, May 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_002371" in other vectors (6)
SKU Description Size Price
RC201256 MAL (Myc-DDK-tagged)-Human mal, T-cell differentiation protein (MAL), transcript variant a 10 ug
$289.00
RC201256L1 Lenti ORF clone of Human mal, T-cell differentiation protein (MAL), transcript variant a, Myc-DDK-tagged 10 ug
$450.00
RC201256L2 Lenti ORF clone of Human mal, T-cell differentiation protein (MAL), transcript variant a, mGFP tagged 10 ug
$450.00
RC201256L3 Lenti ORF clone of Human mal, T-cell differentiation protein (MAL), transcript variant a, Myc-DDK-tagged 10 ug
$450.00
RC201256L4 Lenti ORF clone of Human mal, T-cell differentiation protein (MAL), transcript variant a, mGFP tagged 10 ug
$450.00
SC118699 MAL (untagged)-Human mal, T-cell differentiation protein (MAL), transcript variant a 10 ug
$150.00

Plasmid Map for RG201256

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201256
Circular map for RG201256

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products