OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

elF2 alpha (EIF2S1) (NM_004094) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200368
EIF2S1 (tGFP-tagged) - Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $650.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA501313 Anti-EIF2S1 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4) 100 ul
$447.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "elF2 alpha or NM_004094"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol elF2 alpha
Synonyms EIF-2; EIF-2A; EIF-2alpha; EIF2; EIF2A
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200368 representing NM_004094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGTCTAAGTTGTAGATTTTATCAACACAAATTTCCTGAGGTGGAAGATGTAGTGATGGTGAATG
TCAGATCCATTGCTGAAATGGGGGCTTATGTCAGCTTGCTGGAATACAACAACATTGAAGGCATGATTCT
TCTTAGTGAATTATCCAGAAGGCGTATCCGTTCTATCAACAAACTCATCCGAATTGGCAGGAATGAGTGT
GTGGTTGTCATTAGGGTGGACAAAGAAAAAGGATATATTGATTTGTCAAAAAGAAGAGTTTCTCCAGAGG
AAGCAATCAAATGTGAAGACAAATTCACAAAATCCAAAACTGTTTATAGCATTCTTCGTCATGTTGCTGA
GGTGTTAGAATACACCAAGGATGAGCAGCTGGAAAGCCTATTCCAGAGGACTGCCTGGGTCTTTGATGAC
AAGTACAAGAGACCTGGATATGGTGCCTATGATGCATTTAAGCATGCAGTCTCAGACCCATCTATTTTGG
ATAGTTTAGATTTGAATGAAGATGAACGGGAAGTACTCATTAATAATATTAATAGGCGCTTGACCCCACA
GGCTGTCAAAATTCGAGCAGATATTGAAGTGGCTTGTTATGGTTATGAAGGCATTGATGCTGTAAAAGAA
GCCCTAAGAGCAGGTTTGAATTGTTCTACAGAAAACATGCCCATTAAGATTAATCTAATAGCTCCTCCTC
GGTATGTAATGACTACGACAACCCTGGAGAGAACAGAAGGCCTTTCTGTCCTCAGTCAAGCTATGGCTGT
TATCAAAGAGAAGATTGAGGAAAAGAGGGGTGTGTTCAATGTTCAAATGGAGCCCAAAGTGGTCACAGAT
ACAGATGAGACTGAACTTGCGAGGCAGATGGAGAGGCTTGAAAGAGAAAATGCCGAAGTGGATGGAGATG
ATGATGCAGAAGAAATGGAAGCCAAAGCTGAAGAT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200368 representing NM_004094
Red=Cloning site Green=Tags(s)

MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC
VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD
KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE
ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD
TDETELARQMERLERENAEVDGDDDAEEMEAKAED

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004094
ORF Size 945 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004094.5
RefSeq Size 4165 bp
RefSeq ORF 948 bp
Locus ID 1965
UniProt ID P05198
Cytogenetics 14q23.3
Domains S1
Summary The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit (EIF2S2; MIM 603908), and the 52-kD EIF2-gamma subunit (EIF2S3; MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha (Ernst et al., 1987 PubMed 2948954).supplied by OMIM, Feb 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004094" in other vectors (6)
SKU Description Size Price
RC200368 EIF2S1 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) 10 ug
$450.00
RC200368L1 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), Myc-DDK-tagged 10 ug
$750.00
RC200368L2 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), mGFP tagged 10 ug
$750.00
RC200368L3 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), Myc-DDK-tagged 10 ug
$750.00
RC200368L4 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), mGFP tagged 10 ug
$750.00
SC316720 EIF2S1 (untagged)-Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) 10 ug
$450.00

Plasmid Map for RG200368

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200368
Circular map for RG200368

file-alt Citations

eIF2B localisation and its regulation during the integrated stress response is cell-type specific
Hanson, Ribeiro de Oliveira, Cross et al
iScience (2024)
Cited by 6
AI Summary: OriGene products, specifically the pCMV6-AC-tGFP plasmid vectors encoding EIF2B5 and EIF2S1, were used to generate and verify expression constructs for studying eIF2B localisation and regulation in this research.
Snippet: pCMV6-AC-tGFP plasmid vector encoding EIF2B5 and EIF2S1 was purchased from 697 OriGene (Rockville, Maryland, USA). The coding open reading frame of EIF2B5 from 698 the pCMV6-AC-tGFP vector was cloned into an empty pCMV6-AC-mGFP and empty 699 pCMV6-AC-mRFP vectors. The constructs were verified by sequencing
The role of eIF2Bα in the integrity of eIF2B bodies
Oliveira
Thesis (2023)
Snippet: EIF2B5 (pCMV6-AC-tGFP) Origene RG202322 10 μg/uL EIF2S1 (pCMV6-AC-tGFP) Origene RG200368 10 μg/uL EIF2B1 (pCMV6-AC-tGFP) Origene RG210766 10 μg
The Role of eIF2B Localisation in Cell-specific Stress Responses
Hanson
Thesis (2023)
Snippet: EIF2B5 (pCMV6-AC-tGFP) Origene RG202322 10μg EIF2S1 (pCMV6-AC-tGFP) Origene RG200368 10μg
Cellular eIF2B subunit localization: implications for the integrated stress response and its control by small molecule drugs
Hodgson, Varanda, Ashe et al
Mol. Biol. Cell (2019) 30 (8), 942-958 DOI: 10.1091/mbc.E18-08-0538
AI Summary: OriGene’s pCMV6-AC-GFP and pCMV6-AC-RFP plasmid vectors encoding EIF2B5 and EIF2S1 were used to express and visualize eIF2B subunits in mammalian cells, enabling the study of their localization and role in the integrated stress response.
Snippet: pCMV6-AC-GFP plasmid vectors encoding EIF2B5 and EIF2S1 were purchased from OriGene (Rockville, MD). The coding open reading frame (ORF) of EIF2B5 from the pCMV6-AC-GFP vector was cloned into a pCMV6-AC-RFP vector (OriGene). … Site-directed mutagenesis was performed on the EIF2S1 plasmid to generate an S51A mutation using a QuikChange II Site-Directed Mutagenesis Kit (Agilent, Stockport, UK) in accordance with manufacturer’s instructions. …
FigureFigureFigure
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products