elF2 alpha (EIF2S1) (NM_004094) Human Tagged ORF Clone

SKU
RC200368
EIF2S1 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol elF2 alpha
Synonyms EIF-2; EIF-2A; EIF-2alpha; EIF2; EIF2A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200368 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGTCTAAGTTGTAGATTTTATCAACACAAATTTCCTGAGGTGGAAGATGTAGTGATGGTGAATG
TCAGATCCATTGCTGAAATGGGGGCTTATGTCAGCTTGCTGGAATACAACAACATTGAAGGCATGATTCT
TCTTAGTGAATTATCCAGAAGGCGTATCCGTTCTATCAACAAACTCATCCGAATTGGCAGGAATGAGTGT
GTGGTTGTCATTAGGGTGGACAAAGAAAAAGGATATATTGATTTGTCAAAAAGAAGAGTTTCTCCAGAGG
AAGCAATCAAATGTGAAGACAAATTCACAAAATCCAAAACTGTTTATAGCATTCTTCGTCATGTTGCTGA
GGTGTTAGAATACACCAAGGATGAGCAGCTGGAAAGCCTATTCCAGAGGACTGCCTGGGTCTTTGATGAC
AAGTACAAGAGACCTGGATATGGTGCCTATGATGCATTTAAGCATGCAGTCTCAGACCCATCTATTTTGG
ATAGTTTAGATTTGAATGAAGATGAACGGGAAGTACTCATTAATAATATTAATAGGCGCTTGACCCCACA
GGCTGTCAAAATTCGAGCAGATATTGAAGTGGCTTGTTATGGTTATGAAGGCATTGATGCTGTAAAAGAA
GCCCTAAGAGCAGGTTTGAATTGTTCTACAGAAAACATGCCCATTAAGATTAATCTAATAGCTCCTCCTC
GGTATGTAATGACTACGACAACCCTGGAGAGAACAGAAGGCCTTTCTGTCCTCAGTCAAGCTATGGCTGT
TATCAAAGAGAAGATTGAGGAAAAGAGGGGTGTGTTCAATGTTCAAATGGAGCCCAAAGTGGTCACAGAT
ACAGATGAGACTGAACTTGCGAGGCAGATGGAGAGGCTTGAAAGAGAAAATGCCGAAGTGGATGGAGATG
ATGATGCAGAAGAAATGGAAGCCAAAGCTGAAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200368 protein sequence
Red=Cloning site Green=Tags(s)

MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC
VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD
KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE
ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD
TDETELARQMERLERENAEVDGDDDAEEMEAKAED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004094
ORF Size 945 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004094.5
RefSeq Size 4165 bp
RefSeq ORF 948 bp
Locus ID 1965
UniProt ID P05198
Cytogenetics 14q23.3
Domains S1
MW 36.1 kDa
Summary The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit (EIF2S2; MIM 603908), and the 52-kD EIF2-gamma subunit (EIF2S3; MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha (Ernst et al., 1987 [PubMed 2948954]).[supplied by OMIM, Feb 2010]
Write Your Own Review
You're reviewing:elF2 alpha (EIF2S1) (NM_004094) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200368L1 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), Myc-DDK-tagged 10 ug
$750.00
RC200368L2 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), mGFP tagged 10 ug
$750.00
RC200368L3 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), Myc-DDK-tagged 10 ug
$750.00
RC200368L4 Lenti ORF clone of Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), mGFP tagged 10 ug
$750.00
RG200368 EIF2S1 (tGFP-tagged) - Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) 10 ug
$650.00
SC316720 EIF2S1 (untagged)-Human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.