OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASF1A (NM_014034) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG200324
ASF1A (tGFP-tagged) - Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA349664 Rabbit Polyclonal Anti-ASF1A Antibody
100 ul
$205.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "ASF1A or NM_014034"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ASF1A
Synonyms CGI-98; CIA; HSPC146
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG200324 representing NM_014034
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAAGGTTCAGGTGAACAATGTAGTGGTGCTGGATAACCCTTCTCCTTTCTACAACCCGTTCCAGT
TCGAGATCACCTTCGAGTGCATCGAGGACCTGTCTGAAGACTTGGAATGGAAAATTATCTATGTGGGCTC
TGCAGAAAGTGAAGAATACGATCAAGTTTTAGACTCTGTTTTAGTGGGTCCTGTTCCCGCAGGAAGGCAT
ATGTTTGTATTTCAGGCTGATGCACCTAATCCAGGACTCATTCCAGATGCAGATGCAGTAGGCGTAACTG
TTGTGCTAATTACTTGTACCTATCGAGGACAAGAATTTATTAGAGTTGGCTATTATGTAAATAATGAATA
TACTGAGACAGAATTAAGGGAAAATCCACCAGTAAAACCAGACTTTTCTAAGCTTCAAAGGAATATTTTG
GCATCTAATCCCAGGGTCACAAGATTCCACATTAATTGGGAAGATAACACAGAAAAACTGGAAGATGCAG
AGAGCAGTAATCCAAATCTACAGTCACTTCTTTCAACAGATGCATTACCTTCAGCATCAAAGGGATGGTC
CACATCAGAAAACTCACTAAATGTCATGTTAGAATCCCACATGGACTGCATG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200324 representing NM_014034
Red=Cloning site Green=Tags(s)

MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRH
MFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNIL
ASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014034
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014034.3
RefSeq Size 2525 bp
RefSeq ORF 615 bp
Locus ID 25842
UniProt ID Q9Y294
Cytogenetics 6q22.31
Domains Anti-silence
Summary This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014034" in other vectors (6)
SKU Description Size Price
RC200324 ASF1A (Myc-DDK-tagged)-Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A) 10 ug
$289.00 $300.00
RC200324L1 Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A), Myc-DDK-tagged 10 ug
$600.00
RC200324L2 Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A), mGFP tagged 10 ug
$600.00
RC200324L3 Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A), Myc-DDK-tagged 10 ug
$600.00
RC200324L4 Lenti ORF clone of Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A), mGFP tagged 10 ug
$600.00
SC321540 ASF1A (untagged)-Human ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (ASF1A) 10 ug
$300.00

Plasmid Map for RG200324

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG200324
Circular map for RG200324

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products