OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Aly (ALYREF) (NM_005782) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC229136
ALYREF (Myc-DDK-tagged)-Human THO complex 4 (THOC4)
ORF Plasmid:
DDK DDK tGFP tGFP
Lentiviral Particles:
DDK DDK w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA322556 Anti-ALYREF Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Aly or NM_005782"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Aly
Synonyms ALY; ALY/REF; BEF; REF; THOC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC229136 representing NM_005782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGATTCCGCGCCCGCCATGGCCGACAAAATGGACATGTCTCTGGACGACATCATTAAACTGAACC
GGAGCCAGCGAGGCGGCCGGGGCGGGGGCCGGGGCCGCGGCCGGGCCGGCTCCCAGGGCGGCCGCGGCGG
TGGGGCGCAGGCCGCCGCGCGAGTGAATCGAGGCGGCGGGCCCATCCGGAACCGGCCGGCCATCGCCCGC
GGCGCGGCCGGCGGAGGCGGCAGGAACCGACCGGCGCCCTACAGCAGGCCAAAACAACTTCCCGACAAGT
GGCAGCACGATCTTTTCGACAGTGGCTTCGGCGGTGGTGCCGGCGTGGAGACAGGTGGGAAACTGCTGGT
GTCCAATCTGGATTTTGGAGTCTCAGACGCCGATATTCAGGAACTCTTTGCTGAATTTGGAACGCTGAAG
AAGGCGGCTGTGCACTATGATCGCTCTGGTCGCAGCTTAGGAACAGCAGACGTGCACTTTGAGCGGAAGG
CAGATGCCCTGAAGGCCATGAAGCAGTACAACGGCGTCCCTCTGGATGGCCGCCCCATGAACATTCAGCT
TGTCACGTCACAGATTGACGCACAGCGGAGGCCTGCACAGAGCGTAAACAGAGGTGGCATGACTAGAAAC
CGTGGCGCTGGAGGTTTTGGTGGTGGTGGAGGCACCCGGAGAGGCACCCGCGGAGGCGCCCGTGGAAGAG
GCAGAGGTGCCGGCAGGAATTCAAAGCAGCAGCTTTCGGCAGAGGAGCTGGATGCCCAGCTGGACGCCTA
TAATGCGAGAATGGACACCAGT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC229136 representing NM_005782
Red=Cloning site Green=Tags(s)

MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIAR
GAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLK
KAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRN
RGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005782
ORF Size 792 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005782.4
RefSeq Size 1113 bp
RefSeq ORF 795 bp
Locus ID 10189
UniProt ID Q86V81, E9PB61
Cytogenetics 17q25.3
Protein Pathways Spliceosome
MW 27.6 kDa
Summary The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005782" in other vectors (11)
SKU Description Size Price
RC208627 ALYREF (Myc-DDK-tagged)-Human THO complex 4 (THOC4) 10 ug
$450.00
RC208627L1 Lenti ORF clone of Human THO complex 4 (THOC4), Myc-DDK-tagged 10 ug
$750.00
RC208627L2 Lenti ORF clone of Human THO complex 4 (THOC4), mGFP tagged 10 ug
$750.00
RC208627L3 Lenti ORF clone of Human THO complex 4 (THOC4), Myc-DDK-tagged 10 ug
$750.00
RC208627L4 Lenti ORF clone of Human THO complex 4 (THOC4), mGFP tagged 10 ug
$750.00
RC229136L1 Lenti ORF clone of Human THO complex 4 (THOC4), Myc-DDK-tagged 10 ug
$600.00
RC229136L3 Lenti ORF clone of Human THO complex 4 (THOC4), Myc-DDK-tagged 10 ug
$600.00
RG208627 ALYREF (tGFP-tagged) - Human THO complex 4 (THOC4) 10 ug
$650.00
RG229136 ALYREF (tGFP-tagged) - Human THO complex 4 (THOC4) 10 ug
$489.00 $500.00
SC125907 ALYREF (untagged)-Human THO complex 4 (THOC4) 10 ug
$300.00
SC327771 ALYREF (untagged)-Human THO complex 4 (THOC4) 10 ug
$330.00

Plasmid Map for RC229136

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC229136
Circular map for RC229136

file-alt Citations

5-methylcytosine promotes mRNA export - NSUN2 as the methyltransferase and ALYREF as an m(5)C reader
Yang, Yang, Sun et al
Cell Res. (2017)
AI Summary: OriGene products contributed to this study by providing Myc-Flag-tagged (pCMV6-Entry-ALYREF-Myc-DDK) and GFP-tagged (pCMV6-AC-ALYREF-GFP) human ALYREF plasmids, which were used to investigate the role of ALYREF in mRNA export.
Snippet: Flag-tagged human NSUN1 and NSUN6 plasmids were purchased from Vigene Biosciences, China. Myc-Flag-tagged (pCMV6-Entry-ALYREF-Myc-DDK) and GFP-tagged (pCMV6-AC-ALYREF-GFP) human ALYREF plasmids were purchased from Origene Technologies ... All 3 versions Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products