OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC228166
BHLHA9 (Myc-DDK-tagged)-Human basic helix-loop-helix family, member a9 (BHLHA9)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA368007 BHLHA9 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Class A basic helix loop helix protein 9 or NM_001164405"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Class A basic helix loop helix protein 9
Synonyms BHLHF42; CCSPD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC228166 representing NM_001164405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGGGGCGCGCCAGGACTAGGCCTCACGGCGCGGAAGGGGGCCGAGGACTCTGCGGAGGACTTGG
GGGGCCCCTGCCCCGAGCCCGGGGGCGATTCGGGGGTGCTGGGGGCGAACGGCGCTTCCTGCAGCCGGGG
CGAGGCGGAGGAGCCGGCGGGCAGGAGGCGCGCGCGGCCGGTGCGGTCCAAGGCGCGGCGCATGGCCGCC
AACGTGCGGGAGCGCAAGCGCATCCTAGACTACAACGAGGCCTTCAACGCGCTGCGCCGGGCGCTGCGGC
ACGACCTGGGCGGCAAGAGGCTCTCCAAGATCGCCACGCTGCGCAGGGCCATCCACCGCATCGCCGCGCT
CTCCCTGGTCCTGCGCGCCAGCCCCGCGCCCCGCGGGCCCTGCGGACACCTGGAGTGCCACGGCCCGGCC
GCGCGCGGGGACACCGGGGACACAGGCGCCAGCCCCCCGCCGCCTGCAGGGCCCAGCCTCGCGCGCCCAG
ACGCCGCCCGCCCCTCGGTGCCGTCCGCGCCCCGCTGCGCCTCGTGCCCCCCGCACGCGCCCCTGGCACG
GCCCAGTGCGGTGGCCGAGGGGCCGGGCCTAGCACAGGCCTCCGGGGGAAGCTGGCGCCGCTGTCCGGGG
GCTTCCTCTGCCGGGCCGCCTCCCTGGCCGCGGGGCTACCTGCGATCCGCCCCCGGGATGGGCCATCCGC
GCTCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC228166 representing NM_001164405
Red=Cloning site Green=Tags(s)

MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAA
NVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHGPA
ARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCPPHAPLARPSAVAEGPGLAQASGGSWRRCPG
ASSAGPPPWPRGYLRSAPGMGHPRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001164405
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001164405.2
RefSeq ORF 708 bp
Locus ID 727857
UniProt ID Q7RTU4
Cytogenetics 17p13.3
MW 24 kDa
Summary This gene is a member of the basic helix-loop-helix family. The encoded protein is a transcription factor involved in limb development. Mutations in this gene have been associated with mesoaxial synostotic syndactyly Malik-Percin type (MSSD). Copy number variation of a locus containing this gene has been linked to a form of split-hand/foot malformation with long bone deficiency (SHFLD3). provided by RefSeq, Mar 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001164405" in other vectors (6)
SKU Description Size Price
RC228166L1 Lenti ORF clone of Human basic helix-loop-helix family, member a9 (BHLHA9), Myc-DDK-tagged 10 ug
$600.00
RC228166L2 Lenti ORF clone of Human basic helix-loop-helix family, member a9 (BHLHA9), mGFP tagged 10 ug
$600.00
RC228166L3 Lenti ORF clone of Human basic helix-loop-helix family, member a9 (BHLHA9), Myc-DDK-tagged 10 ug
$600.00
RC228166L4 Lenti ORF clone of Human basic helix-loop-helix family, member a9 (BHLHA9), mGFP tagged 10 ug
$600.00
RG228166 BHLHA9 (tGFP-tagged) - Human basic helix-loop-helix family, member a9 (BHLHA9) 10 ug
$500.00
SC326801 BHLHA9 (untagged)-Human basic helix-loop-helix family member a9 (BHLHA9) 10 ug
$300.00

Plasmid Map for RC228166

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC228166
Circular map for RC228166

file-alt Citations

Mutations Affecting the BHLHA9 DNA-Binding Domain Cause MSSD, Mesoaxial Synostotic Syndactyly with Phalangeal Reduction, Malik-Percin Type
Malik, Percin, Bornholdt et al
American Journal of Human Genetics (2014)
Snippet: translated segment of Homo sapiens (Hs) basic helix-loop-helix family member A9 cDNA (BHLHA9) in pCMV6-Entry (C-terminal Myc and DDK tagged) (pCMV6_HsBHLHA9/ wt) and pCMV6-Entry (C-terminal Myc and DDK tagged) were obtained from OriGene The ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products