OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SSX3 (NM_021014) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC224933
SSX3 (Myc-DDK-tagged)-Human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA345316 Rabbit Polyclonal Anti-SSX3 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SSX3 or NM_021014"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SSX3
Synonyms CT5.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224933 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGAGATGACACCTTTGCAAGGAGACCCACGGTTGGTGCTCAAATACCAGAGAAGATACAAAAGG
CCTTCGATGATATTGCCAAATACTTCTCTAAGGAAGAGTGGGAAAAGATGAAAGTCTCGGAGAAAATCGT
CTATGTGTATATGAAGAGAAAGTATGAGGCCATGACTAAACTAGGTTTCAAGGCCATCCTCCCATCTTTC
ATGCGTAATAAACGGGTCACAGACTTCCAGGGGAATGATTTTGATAATGACCCTAACCGTGGGAATCAGG
TTCAACGTCCTCAGATGACTTTCGGCAGGCTCCAGGGAATCTTCCCGAAGATCATGCCCAAGAAGCCAGC
AGAGGAAGGAAATGTTTCGAAGGAAGTGCCAGAAGCATCTGGCCCACAAAACGATGGGAAACAGCTGTGC
CCCCCGGGAAAACCAACTACCTCTGAGAAGATTAACATGATATCTGGACCCAAAAGGGGGGAACATGCCT
GGACCCACAGACTGCGTGAGAGAAAGCAGCTGGTGATTTATGAAGAGATCAGCGATCCTGAGGAAGATGA
TGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC224933 protein sequence
Red=Cloning site Green=Tags(s)

MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF
MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC
PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021014
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021014.4
RefSeq Size 1336 bp
RefSeq ORF 567 bp
Locus ID 10214
UniProt ID Q99909
Cytogenetics Xp11.23
Protein Families Transcription Factors
MW 21.7 kDa
Summary The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. While some of the related SSX genes are involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas, this gene does not appear to be involved in such translocations. provided by RefSeq, Jul 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_021014" in other vectors (4)
SKU Description Size Price
RC224933L3 Lenti ORF clone of Human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC224933L4 Lenti ORF clone of Human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1, mGFP tagged 10 ug
$600.00
RG224933 SSX3 (tGFP-tagged) - Human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1 10 ug
$500.00
SC304892 SSX3 (untagged)-Human synovial sarcoma, X breakpoint 3 (SSX3), transcript variant 1 10 ug
$300.00

Plasmid Map for RC224933

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC224933
Circular map for RC224933

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products