OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SGLT2 (SLC5A2) (NM_003041) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC224822
SLC5A2 (Myc-DDK-tagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $615.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA314540 Rabbit polyclonal anti-SLC5A2 antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SGLT2 or NM_003041"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SGLT2
Synonyms SGLT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224822 representing NM_003041
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCACACAGAGGCAGGCTCGGCACCAGAGATGGGGGCCCAGAAGGCCCTGATTGACAATCCTG
CTGACATCCTAGTCATTGCTGCATATTTCCTGCTGGTCATTGGCGTTGGCTTGTGGTCCATGTGCAGAAC
CAACAGAGGCACTGTGGGCGGCTACTTCCTGGCAGGACGCAGCATGGTGTGGTGGCCGGTTGGGGCCTCT
CTCTTCGCCAGCAACATCGGCAGTGGCCACTTTGTGGGCCTGGCAGGGACTGGCGCTGCAAGTGGCTTGG
CTGTTGCTGGATTCGAGTGGAATGCGCTCTTCGTGGTGCTGCTACTGGGCTGGCTGTTTGCACCCGTGTA
CCTGACAGCGGGGGTCATCACGATGCCACAGTACCTGCGCAAGCGCTTCGGCGGCCGCCGCATCCGCCTC
TACCTGTCTGTGCTCTCCCTTTTCCTGTACATCTTCACCAAGATCTCAGTGGACATGTTCTCCGGAGCTG
TATTCATCCAGCAGGCTCTGGGCTGGAACATCTATGCCTCCGTCATCGCGCTTCTGGGCATCACCATGAT
TTACACGGTGACAGGAGGGCTGGCCGCGCTGATGTACACGGACACGGTACAGACCTTCGTCATTCTGGGG
GGCGCCTGCATCCTCATGGGTTACGCCTTCCACGAGGTGGGCGGGTATTCGGGTCTCTTCGACAAATACC
TGGGAGCAGCGACTTCGCTGACGGTGTCCGAGGATCCAGCCGTGGGAAACATCTCCAGCTTCTGCTATCG
ACCCCGGCCCGACTCCTACCACCTGCTCCGGCACCCCGTGACCGGGGATCTGCCGTGGCCCGCGCTGCTC
CTCGGACTCACAATCGTCTCGGGCTGGTACTGGTGCAGCGACCAGGTCATCGTGCAGCGCTGCCTGGCCG
GGAAGAGCCTGACCCACATCAAGGCGGGCTGCATCCTGTGTGGGTACCTGAAGCTGACGCCCATGTTTCT
CATGGTCATGCCAGGCATGATCAGCCGCATTCTGTACCCAGACGAGGTGGCGTGCGTGGTGCCTGAGGTG
TGCAGGCGCGTGTGCGGCACGGAGGTGGGCTGCTCCAACATCGCCTACCCGCGGCTCGTCGTGAAGCTCA
TGCCCAACGGTCTGCGCGGACTCATGCTGGCGGTCATGCTGGCCGCGCTCATGTCCTCGCTGGCCTCCAT
CTTCAACAGCAGCAGCACGCTCTTCACCATGGACATCTACACGCGCCTGCGGCCACGCGCCGGCGACCGC
GAGCTGCTGCTGGTGGGACGGCTCTGGGTGGTGTTCATCGTGGTAGTGTCGGTGGCCTGGCTTCCCGTGG
TGCAGGCGGCACAGGGCGGGCAGCTCTTCGATTACATCCAGGCAGTCTCTAGCTACCTGGCACCGCCCGT
GTCCGCCGTCTTCGTGCTGGCGCTCTTCGTGCCGCGCGTTAATGAGCAGGGCGCCTTCTGGGGACTCATC
GGGGGCCTGCTGATGGGCCTGGCACGCCTGATTCCCGAGTTCTCCTTCGGCTCGGGCAGCTGTGTGCAGC
CCTCGGCGTGCCCAGCTTTCCTCTGCGGCGTGCACTACCTCTACTTCGCCATTGTGCTGTTCTTCTGCTC
TGGCCTCCTCACCCTCACGGTCTCCCTGTGCACCGCGCCCATCCCCAGAAAGCACCTCCACCGCCTGGTC
TTCAGTCTCCGGCATAGCAAGGAGGAACGGGAGGACCTGGATGCTGATGAGCAGCAAGGCTCCTCACTCC
CTGTACAGAATGGGTGCCCAGAGAGTGCCATGGAGATGAATGAGCCCCAGGCCCCGGCACCAAGCCTCTT
CCGCCAGTGCCTGCTCTGGTTTTGTGGAATGAGCAGAGGTGGGGTGGGCAGTCCTCCGCCCCTTACCCAG
GAGGAGGCAGCGGCAGCAGCCAGGCGGCTGGAGGACATCAGCGAGGACCCGAGCTGGGCCCGTGTGGTCA
ACCTCAATGCCCTGCTCATGATGGCAGTGGCCGTGTTCCTCTGGGGCTTCTATGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC224822 representing NM_003041
Red=Cloning site Green=Tags(s)

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS
LFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRL
YLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILG
GACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALL
LGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEV
CRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLI
GGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLV
FSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGSPPPLTQ
EEAAAAARRLEDISEDPSWARVVNLNALLMMAVAVFLWGFYA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003041
ORF Size 2016 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003041.4
RefSeq Size 2271 bp
RefSeq ORF 2019 bp
Locus ID 6524
UniProt ID P31639
Cytogenetics 16p11.2
Protein Families Transmembrane
MW 72.7 kDa
Summary This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Two transcript variants, one protein-coding and one not, have been found for this gene. provided by RefSeq, Feb 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003041" in other vectors (6)
SKU Description Size Price
RC224822L1 Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2), Myc-DDK-tagged 10 ug
$915.00
RC224822L2 Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2), mGFP tagged 10 ug
$915.00
RC224822L3 Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2), Myc-DDK-tagged 10 ug
$915.00
RC224822L4 Lenti ORF clone of Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2), mGFP tagged 10 ug
$915.00
RG224822 SLC5A2 (tGFP-tagged) - Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2) 10 ug
$789.00 $815.00
SC303267 SLC5A2 (untagged)-Human solute carrier family 5 (sodium/glucose cotransporter), member 2 (SLC5A2) 10 ug
$616.00

Plasmid Map for RC224822

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC224822
Circular map for RC224822

file-alt Citations

Pharmacological evaluation of HM41322, a novel SGLT1/2 dual inhibitor, in vitro and in vivo
Lee, Lee, Kim et al
Korean J. Physiol. Pharmacol. (2019) 23 (1), 55-62 DOI: 10.4196/kjpp.2019.23.1.55
AI Summary: OriGene contributed to this study by providing human SGLT1 and SGLT2 cDNA, which were used to assess the inhibitory effects of HM41322 in in vitro functional assays.
Snippet: Fig. 1 Chemical structure of HM41322. Click for larger image. In vitro functional assay. HEK293 cells were purchased from the Korean Cell Line Bank (Seoul, Korea). Human SGLT1 and human SGLT2 cDNA were purchased from OriGene (Rockville, MD, USA) Cached
FigureFigureFigure
Concise and Stereodivergent Synthesis of Carbasugars Reveals Unexpected Structure-Activity Relationship (SAR) of SGLT2 Inhibition
Ng, Li, Lau et al
Sci Rep (2017) 7 (1), 5581 DOI: 10.1038/s41598-017-05895-9
AI Summary: OriGene’s human SGLT2 (SLC5A2, NM_003041) cDNA clone was used in this study to facilitate the expression and functional analysis of SGLT2, enabling the evaluation of inhibitory activity and structure-activity relationships of newly synthesized carbasugar compounds.
Snippet: attrs":{"text":"NM_000343","term_id":"291575123","term_text":"NM_000343"}} NM_000343) or SLC5A2 ({"type":"entrez-nucleotide","attrs":{"text":"NM_003041","term_id":" 164663744","term_text":"NM_003041"}}NM_003041) human cDNA clone (Origene Technologies ... … attrs":{"text":"NM_000343","term_id":"291575123","term_text":"NM_000343"}} NM_000343) or SLC5A2 ({"type":"entrez-nucleotide","attrs":{"text":"NM_003041","term_id":" 164663744","term_text":"NM_003041"}}NM_003041) human cDNA clone (Origene Technologies ... …
FigureFigureFigure
Targeting Type 2 Diabetes with C-Glucosyl Dihydrochalcones as Selective Sodium Glucose Co-Transporter 2 (SGLT2) Inhibitors: Synthesis and Biological Evaluation
Jesus, Vila-Viçosa, Machuqueiro et al
J Med Chem (2017) 60 (2), 568-579 DOI: 10.1021/acs.jmedchem.6b01134
Cited by 63
AI Summary: OriGene products, specifically the human SGLT1 (NM_000343) and SGLT2 (NM_003041) cDNA clones, were used to express these transporters in cell-based assays, enabling the evaluation of the inhibitory activity and selectivity of synthesized C-glucosyl dihydrochalcones toward SGLT2.
SHR3824, a novel selective inhibitor of renal sodium glucose cotransporter 2, exhibits antidiabetic efficacy in rodent models
Yan, Zhang, Feng et al
Acta Pharmacol. Sin. (2014) 35 (5), 613-24 DOI: 10.1038/aps.2013.196
Cited by 12
AI Summary: OriGene products contributed to this study by providing human SGLT1 and SGLT2 cDNA, which were used to assess the in vitro potency and selectivity of the novel SGLT2 inhibitor SHR3824.
Snippet: Medica, Chinese Academy of Sciences. The Inhibitory Effects on Human SGLT1 and SGLT2. Human SGLT1 or SGLT2 cDNA (OriGene Technologies, Rockville, MD, USA) was ligated into the pCDNA3.1 vector. For the AMG (alpha ... Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products