OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOBP (NM_182935) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC223946
MOBP (Myc-DDK-tagged)-Human myelin-associated oligodendrocyte basic protein (MOBP)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA337719 Rabbit Polyclonal Anti-MOBP Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "MOBP or NM_182935"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MOBP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223946 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCAGAAACCGGCCAAGGAGGGTCCCAGACTCTCCAAAAACCAGAAGTACTCCGAACACTTCAGCA
TACACTGCTGCCCGCCGTTCACCTTCCTCAATTCCAAGAAGGAGATAGTGGATCGGAAATACAGCATCTG
TAAGAGCGGCTGCTTCTACCAGAAGAAAGAGGAGGACTGGATCTGCTGCGCCTGCCAGAAGACCAGATTG
AAAAGGAAGATCAGGCCAACCCCAAAGAAGAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223946 protein sequence
Red=Cloning site Green=Tags(s)

MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL
KRKIRPTPKKK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_182935
ORF Size 243 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182935.4
RefSeq Size 3083 bp
RefSeq ORF 246 bp
Locus ID 4336
UniProt ID Q13875, A0A0S2Z3W1
Cytogenetics 3p22.1
MW 9.6 kDa
Summary May play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively charged acidic phospholipids of the cytoplasmic membrane.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_182935" in other vectors (4)
SKU Description Size Price
RC223946L3 Lenti ORF clone of Human myelin-associated oligodendrocyte basic protein (MOBP), Myc-DDK-tagged 10 ug
$450.00
RC223946L4 Lenti ORF clone of Human myelin-associated oligodendrocyte basic protein (MOBP), mGFP tagged 10 ug
$450.00
RG223946 MOBP (tGFP-tagged) - Human myelin-associated oligodendrocyte basic protein (MOBP) 10 ug
$489.00
SC111885 MOBP (untagged)-Human myelin-associated oligodendrocyte basic protein (MOBP) 10 ug
$150.00

Plasmid Map for RC223946

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223946
Circular map for RC223946

file-alt Citations

Exploring the expression patterns of palmitoylating and de-palmitoylating enzymes in the mouse brain using the curated RNA-seq database BrainPalmSeq
Wild, Hogg, Flibotte et al
Elife (2022) 11 DOI: 10.7554/eLife.75804
AI Summary: OriGene products—specifically FLAG-MOBP (CAT#: RC223946), FLAG-PLP1 (CAT#: RC218616), and FLAG-CNP—were used as recombinant DNA reagents to study and validate the expression and interactions of palmitoylating enzymes and their substrates in the mouse brain.
Snippet: gent FLAG-GOLGA7 Gift from Maurine Linder Washington University School of Medicine Recombinant DNA reagent HA-ZDHHC9 Shimell et al., 2019 Recombinant DNA reagent FLAG-MOBP Origene, Maryland, USA CAT#: RC223946 Recombinant DNA reagent FLAG-PLP1 Origene, Maryland, USA CAT#: RC218616 Recombinant DNA reagent FLAG-CNP Origene, Maryland, USA CAT#:
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products