OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPR34 (NM_001097579) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC223795
GPR34 (Myc-DDK-tagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 4
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA313952 Rabbit polyclonal anti-GPR34 antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GPR34 or NM_001097579"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPR34
Synonyms LYPSR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223795 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAAGTCATACCATAACAATGACGACAACTTCAGTCAGCAGCTGGCCTTACTCCTCCCACAGAATGC
GCTTTATAACCAATCATAGCGACCAACCGCCACAAAACTTCTCAGCAACACCAAATGTTACTACCTGTCC
CATGGATGAAAAATTGCTATCTACTGTGTTAACCACATCCTACTCTGTTATTTTCATCGTGGGACTGGTT
GGGAACATAATCGCCCTCTATGTATTTCTGGGTATTCACCGTAAAAGAAATTCCATTCAAATTTATCTAC
TTAACGTAGCCATTGCAGACCTCCTACTCATCTTCTGCCTCCCTTTCCGAATAATGTATCATATTAACCA
AAACAAGTGGACACTAGGTGTGATTCTGTGCAAGGTTGTGGGAACACTGTTTTATATGAACATGTACATT
AGCATTATTTTGCTTGGATTCATCAGTTTGGATCGCTATATAAAAATTAATCGGTCTATACAGCAACGGA
AGGCAATAACAACCAAACAAAGTATTTATGTCTGTTGTATAGTATGGATGCTTGCTCTTGGTGGATTCCT
AACTATGATTATTTTAACACTTAAGAAAGGAGGGCATAATTCCACAATGTGTTTCCATTACAGAGATAAG
CATAACGCAAAAGGAGAAGCCATTTTTAACTTCATTCTTGTGGTAATGTTCTGGCTAATTTTCTTACTAA
TAATCCTTTCATATATTAAGATTGGGAAGAATCTATTGAGGATTTCTAAAAGGAGGTCAAAATTTCCTAA
TTCTGGTAAATATGCCACTACAGCTCGTAACTCCTTTATTGTACTTATCATTTTTACTATATGTTTTGTT
CCCTATCATGCCTTTCGATTCATCTACATTTCTTCACAGCTAAATGTATCATCTTGCTACTGGAAAGAAA
TTGTTCACAAAACCAATGAGATCATGCTGGTTCTCTCATCTTTCAATAGTTGCTTAGATCCAGTCATGTA
TTTCCTGATGTCCAGTAACATTCGCAAAATAATGTGCCAACTTCTTTTTAGACGATTTCAAGGTGAACCA
AGTAGGAGTGAAAGCACTTCAGAATTTAAACCAGGATACTCCCTGCATGATACATCTGTGGCAGTGAAAA
TACAGTCTAGTTCTAAAAGTACT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223795 protein sequence
Red=Cloning site Green=Tags(s)

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLV
GNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYI
SIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDK
HNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFV
PYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP
SRSESTSEFKPGYSLHDTSVAVKIQSSSKST

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001097579
ORF Size 1143 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001097579.2
RefSeq Size 1938 bp
RefSeq ORF 1146 bp
Locus ID 2857
UniProt ID Q9UPC5
Cytogenetics Xp11.4
Protein Families Druggable Genome, GPCR, Transmembrane
MW 43.9 kDa
Summary G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.supplied by OMIM, Apr 2006
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001097579" in other vectors (6)
SKU Description Size Price
RC223795L1 Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC223795L2 Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, mGFP tagged 10 ug
$757.00
RC223795L3 Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, Myc-DDK-tagged 10 ug
$757.00
RC223795L4 Lenti ORF clone of Human G protein-coupled receptor 34 (GPR34), transcript variant 4, mGFP tagged 10 ug
$757.00
RG223795 GPR34 (tGFP-tagged) - Human G protein-coupled receptor 34 (GPR34), transcript variant 4 10 ug
$657.00
SC316196 GPR34 (untagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 4 10 ug
$503.00

Plasmid Map for RC223795

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223795
Circular map for RC223795

file-alt Citations

G-protein coupled receptor 34 activates Erk and phosphatidylinositol 3-kinase/Akt pathways and functions as alternative pathway to mediate p185Bcr–Abl-induced transformation and leukemogenesisRead More: http://informahealthcare.com/doi/abs/10.3109/10428194.2014.981177
Zuo, Li, Liu et al
Leuk. Lymphoma (2014)
Cited by 16
AI Summary: OriGene contributed to this paper by providing the human GPR34 cDNA (NM_001097579.1, GPR34 transcript variant-4) vector, which was used to study the role of GPR34 in alternative signaling pathways mediating leukemogenesis.
Snippet: by the manufacturer's instructions. The vector containing human GPR34 cDNA (NM_001097579.1,GPR34 transcript variant-4) was purchased from OriGene Technologies, Inc. (Rockville, MD, USA). Gpr34-knockdown or GPR34 ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products